Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-15, Rat (His)

The GDF-15 protein regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. Binds to its receptor GFRAL and activates GFRAL-expressing neurons in the brainstem, triggering the "stress response circuit." GDF-15 Protein, Rat (His) is the recombinant rat-derived GDF-15 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

GDF-15 Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-15-protein-rat-his.html

Purity

95.00

Smiles

SAHLHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHALIKARLHGLQPDRVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVAQGCHCA

Molecular Formula

29455 (Gene_ID) Q9Z0J6 (S189-A303) (Accession)

Molecular Weight

15-17 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm5955 3'UTR Luciferase Stable Cell Line
TU108336 1.0 mL

Gm5955 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
AOC3 Antibody
R33411-100UG 100 µg

AOC3 Antibody

Sign In for Pricing
View Details
Anti-LPIN2 antibody
STJ192442 200 µl

Anti-LPIN2 antibody

Sign In for Pricing
View Details
Mebeverine D6 Hydrochloride
MF-0022899-01 10mg

Mebeverine D6 Hydrochloride

Sign In for Pricing
View Details
Mebeverine D6 Hydrochloride
MF-0022899-02 1g

Mebeverine D6 Hydrochloride

Sign In for Pricing
View Details
Mebeverine D6 Hydrochloride
MF-0022899-03 1mg

Mebeverine D6 Hydrochloride

Sign In for Pricing
View Details