Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-15, Rat (His)

The GDF-15 protein regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. Binds to its receptor GFRAL and activates GFRAL-expressing neurons in the brainstem, triggering the "stress response circuit." GDF-15 Protein, Rat (His) is the recombinant rat-derived GDF-15 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

GDF-15 Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-15-protein-rat-his.html

Purity

95.00

Smiles

SAHLHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHALIKARLHGLQPDRVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVAQGCHCA

Molecular Formula

29455 (Gene_ID) Q9Z0J6 (S189-A303) (Accession)

Molecular Weight

15-17 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF3D Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV670914 1.0 µg DNA

EIF3D Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
VPS18 Recombinant Antibody, APC-Cy5.5 Conjugated
bsm-62138R-APC-Cy5.5 100 µL

VPS18 Recombinant Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
B-Raf IN 5
HY-142820 1 Each

B-Raf IN 5

Sign In for Pricing
View Details
Shiitake Mushroom Extract
C02992 5 mg

Shiitake Mushroom Extract

Sign In for Pricing
View Details
Factor XI, Human
MBS635177-01 0.1 mg

Factor XI, Human

Sign In for Pricing
View Details
Factor XI, Human
MBS635177-02 5x 0.1 mg

Factor XI, Human

Sign In for Pricing
View Details