Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-15, Rat (His)

The GDF-15 protein regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. Binds to its receptor GFRAL and activates GFRAL-expressing neurons in the brainstem, triggering the "stress response circuit." GDF-15 Protein, Rat (His) is the recombinant rat-derived GDF-15 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

GDF-15 Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-15-protein-rat-his.html

Purity

95.00

Smiles

SAHLHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHALIKARLHGLQPDRVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVAQGCHCA

Molecular Formula

29455 (Gene_ID) Q9Z0J6 (S189-A303) (Accession)

Molecular Weight

15-17 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Angiopoietin like 7 (ANGPTL7) (NM_021146) Human Tagged ORF Clone Lentiviral Particle
RC200321L2V 200 µL

Angiopoietin like 7 (ANGPTL7) (NM_021146) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Monoclonal Antibody to Inhibin alpha (Clone: ABM44F5)
10-7553-25 25 µg

Monoclonal Antibody to Inhibin alpha (Clone: ABM44F5)

Sign In for Pricing
View Details
Influenza A H1N1 (A/Texas/05/2009) Hemagglutinin/HA Protein (His)
MF-0133469-01 5 µg

Influenza A H1N1 (A/Texas/05/2009) Hemagglutinin/HA Protein (His)

Sign In for Pricing
View Details
Influenza A H1N1 (A/Texas/05/2009) Hemagglutinin/HA Protein (His)
MF-0133469-02 10 µg

Influenza A H1N1 (A/Texas/05/2009) Hemagglutinin/HA Protein (His)

Sign In for Pricing
View Details
Influenza A H1N1 (A/Texas/05/2009) Hemagglutinin/HA Protein (His)
MF-0133469-03 20 µg

Influenza A H1N1 (A/Texas/05/2009) Hemagglutinin/HA Protein (His)

Sign In for Pricing
View Details
Influenza A H1N1 (A/Texas/05/2009) Hemagglutinin/HA Protein (His)
MF-0133469-04 50 µg

Influenza A H1N1 (A/Texas/05/2009) Hemagglutinin/HA Protein (His)

Sign In for Pricing
View Details