Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-15, Rat (His)

The GDF-15 protein regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. Binds to its receptor GFRAL and activates GFRAL-expressing neurons in the brainstem, triggering the "stress response circuit." GDF-15 Protein, Rat (His) is the recombinant rat-derived GDF-15 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

GDF-15 Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-15-protein-rat-his.html

Purity

95.00

Smiles

SAHLHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHALIKARLHGLQPDRVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVAQGCHCA

Molecular Formula

29455 (Gene_ID) Q9Z0J6 (S189-A303) (Accession)

Molecular Weight

15-17 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Fgr Protein - (Dry Ice)
H00002268-P01-10ug 10 µg

Recombinant Human Fgr Protein - (Dry Ice)

Sign In for Pricing
View Details
ALK Antibody
E30AC1316 100 µL

ALK Antibody

Sign In for Pricing
View Details
PCMV-STK38-3xMyc-Neo Plasmid
PVT69388 2 µg

PCMV-STK38-3xMyc-Neo Plasmid

Sign In for Pricing
View Details
Cdc27 (C-4) AC
sc-13154 AC 500 µg/mL - 25% ag

Cdc27 (C-4) AC

Sign In for Pricing
View Details
MFF Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV659875 1.0 µg DNA

MFF Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
S100A10 Human shRNA Plasmid Kit (Locus ID 6281)
TF318902 1 Kit

S100A10 Human shRNA Plasmid Kit (Locus ID 6281)

Sign In for Pricing
View Details