Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-15, Rat (His)

The GDF-15 protein regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. Binds to its receptor GFRAL and activates GFRAL-expressing neurons in the brainstem, triggering the "stress response circuit." GDF-15 Protein, Rat (His) is the recombinant rat-derived GDF-15 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

GDF-15 Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-15-protein-rat-his.html

Purity

95.00

Smiles

SAHLHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHALIKARLHGLQPDRVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVAQGCHCA

Molecular Formula

29455 (Gene_ID) Q9Z0J6 (S189-A303) (Accession)

Molecular Weight

15-17 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NAC Agar Medium
LA6200 250 g

NAC Agar Medium

Sign In for Pricing
View Details
Cyclin E1 (CCNE1) (NM_001238) Human Recombinant Protein
TP762098 50 µg

Cyclin E1 (CCNE1) (NM_001238) Human Recombinant Protein

Sign In for Pricing
View Details
Rabbit Polyclonal FLRT1 Antibody [DyLight 650]
NBP2-97173C 0.1 mL

Rabbit Polyclonal FLRT1 Antibody [DyLight 650]

Sign In for Pricing
View Details
Rabbit Polyclonal RPA70 Antibody [Alexa Fluor 700]
NB100-2204AF700 0.1 mL

Rabbit Polyclonal RPA70 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
TPSAB1 (TPS1, TPS2, TPSB1, Tryptase alpha/beta-1, Tryptase I, Tryptase alpha-1) (MaxLight 405)
MBS6193149-01 0.1 mL

TPSAB1 (TPS1, TPS2, TPSB1, Tryptase alpha/beta-1, Tryptase I, Tryptase alpha-1) (MaxLight 405)

Sign In for Pricing
View Details
TPSAB1 (TPS1, TPS2, TPSB1, Tryptase alpha/beta-1, Tryptase I, Tryptase alpha-1) (MaxLight 405)
MBS6193149-02 5x 0.1 mL

TPSAB1 (TPS1, TPS2, TPSB1, Tryptase alpha/beta-1, Tryptase I, Tryptase alpha-1) (MaxLight 405)

Sign In for Pricing
View Details