Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-15, Rat (His)

The GDF-15 protein regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. Binds to its receptor GFRAL and activates GFRAL-expressing neurons in the brainstem, triggering the "stress response circuit." GDF-15 Protein, Rat (His) is the recombinant rat-derived GDF-15 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

GDF-15 Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-15-protein-rat-his.html

Purity

95.00

Smiles

SAHLHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHALIKARLHGLQPDRVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVAQGCHCA

Molecular Formula

29455 (Gene_ID) Q9Z0J6 (S189-A303) (Accession)

Molecular Weight

15-17 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat MANF Protein
NBP2-61342-100ug 100 µg

Recombinant Rat MANF Protein

Sign In for Pricing
View Details
Recombinant Chlamydophila Trachomatis nrdR Protein (aa 1-154) (strain UCH-1/proctitis)
VAng-Lsx6892-1mgEcoli 1 mg (E. coli)

Recombinant Chlamydophila Trachomatis nrdR Protein (aa 1-154) (strain UCH-1/proctitis)

Sign In for Pricing
View Details
TRNAA6 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV751010 1.0 µg DNA

TRNAA6 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Mouse Monoclonal ROBO2 Antibody (356001) [mFluor Violet 610 SE]
FAB3147MFV610 0.1 mL

Mouse Monoclonal ROBO2 Antibody (356001) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
MOX1, Control Peptide (Homeobox Protein MOX-1, Mesenchyme Homeobox 1, MEOX1)
149509 50 µg

MOX1, Control Peptide (Homeobox Protein MOX-1, Mesenchyme Homeobox 1, MEOX1)

Sign In for Pricing
View Details
PROTAC KSP degrader 1
HY-168725 1 Each

PROTAC KSP degrader 1

Sign In for Pricing
View Details