Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-15, Rat (His)

The GDF-15 protein regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. Binds to its receptor GFRAL and activates GFRAL-expressing neurons in the brainstem, triggering the "stress response circuit." GDF-15 Protein, Rat (His) is the recombinant rat-derived GDF-15 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

GDF-15 Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-15-protein-rat-his.html

Purity

95.00

Smiles

SAHLHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHALIKARLHGLQPDRVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVAQGCHCA

Molecular Formula

29455 (Gene_ID) Q9Z0J6 (S189-A303) (Accession)

Molecular Weight

15-17 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL12 Protein Vector (Rat) (pPB-C-His)
PV302138 500 ng

RPL12 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
ARHGAP23 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0116305 3x 1.0 µg

ARHGAP23 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Siglec-10 hFc Chimera[Biotin], Avi, Human
Z04597-100 100 µg

Siglec-10 hFc Chimera[Biotin], Avi, Human

Sign In for Pricing
View Details
RTKN Protein Vector (Human) (pPB-N-His)
PV036498 500 ng

RTKN Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Alkaline Phosphatase (CIP/CIAP), Calf Intestinal
MBS173171-01 2500 Units

Alkaline Phosphatase (CIP/CIAP), Calf Intestinal

Sign In for Pricing
View Details
Alkaline Phosphatase (CIP/CIAP), Calf Intestinal
MBS173171-02 25 K Units

Alkaline Phosphatase (CIP/CIAP), Calf Intestinal

Sign In for Pricing
View Details