GDF-15, Rat (His)
The GDF-15 protein regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. Binds to its receptor GFRAL and activates GFRAL-expressing neurons in the brainstem, triggering the "stress response circuit." GDF-15 Protein, Rat (His) is the recombinant rat-derived GDF-15 protein, expressed by E. coli , with N-His labeled tag.
Product Specifications
Product Name Alternative
GDF-15 Protein, Rat (His), Rat, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/gdf-15-protein-rat-his.html
Purity
95.00
Smiles
SAHLHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHALIKARLHGLQPDRVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVAQGCHCA
Molecular Formula
29455 (Gene_ID) Q9Z0J6 (S189-A303) (Accession)
Molecular Weight
15-17 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
Recombinant Escherichia coli Two-component-system connector protein SafA (safA), partial
MS4A1, CT (MS4A1, CD20, B-lymphocyte antigen CD20, B-lymphocyte surface antigen B1, Bp35, Leukocyte surface antigen Leu-16, Membrane-spanning 4-domains subfamily A member 1, CD20) (MaxLight 750)
MS4A1, CT (MS4A1, CD20, B-lymphocyte antigen CD20, B-lymphocyte surface antigen B1, Bp35, Leukocyte surface antigen Leu-16, Membrane-spanning 4-domains subfamily A member 1, CD20) (MaxLight 750)
![TACC3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8B7]](https://cdn.genprice.uk/products/937/68dd1b66061270361ea147a6/imageurl/ta501255bm.webp)
TACC3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8B7]
