Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-15, Rat (His)

The GDF-15 protein regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. Binds to its receptor GFRAL and activates GFRAL-expressing neurons in the brainstem, triggering the "stress response circuit." GDF-15 Protein, Rat (His) is the recombinant rat-derived GDF-15 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

GDF-15 Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-15-protein-rat-his.html

Purity

95.00

Smiles

SAHLHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHALIKARLHGLQPDRVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVAQGCHCA

Molecular Formula

29455 (Gene_ID) Q9Z0J6 (S189-A303) (Accession)

Molecular Weight

15-17 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Clusterin (CLU) Antibody
abx111697 100 µL

Clusterin (CLU) Antibody

Sign In for Pricing
View Details
Zpbp2 (NM_027061) Mouse Tagged ORF Clone Lentiviral Particle
MR218025L3V 200 µL

Zpbp2 (NM_027061) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
3-Hydroxyhexadecanoyl-d3-carnitine Chloride
426034-01 500 µg

3-Hydroxyhexadecanoyl-d3-carnitine Chloride

Sign In for Pricing
View Details
3-Hydroxyhexadecanoyl-d3-carnitine Chloride
426034-02 5 mg

3-Hydroxyhexadecanoyl-d3-carnitine Chloride

Sign In for Pricing
View Details
TRNAE28P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
47994061 1.0 µg DNA

TRNAE28P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Human Troponin T, fast skeletal muscle ELISA Kit
MBS289632-01 48 Well

Human Troponin T, fast skeletal muscle ELISA Kit

Sign In for Pricing
View Details