Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-15, Rat (His)

The GDF-15 protein regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. Binds to its receptor GFRAL and activates GFRAL-expressing neurons in the brainstem, triggering the "stress response circuit." GDF-15 Protein, Rat (His) is the recombinant rat-derived GDF-15 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

GDF-15 Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-15-protein-rat-his.html

Purity

95.00

Smiles

SAHLHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHALIKARLHGLQPDRVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVAQGCHCA

Molecular Formula

29455 (Gene_ID) Q9Z0J6 (S189-A303) (Accession)

Molecular Weight

15-17 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DGAT2L6 Pre-designed siRNA Set A
SI004226A 1 Each

Human DGAT2L6 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Carbetocin Impurity 5 (β-Asp5)
RM-C010505-01 10 mg

Carbetocin Impurity 5 (β-Asp5)

Sign In for Pricing
View Details
Carbetocin Impurity 5 (β-Asp5)
RM-C010505-02 25 mg

Carbetocin Impurity 5 (β-Asp5)

Sign In for Pricing
View Details
Carbetocin Impurity 5 (β-Asp5)
RM-C010505-03 50 mg

Carbetocin Impurity 5 (β-Asp5)

Sign In for Pricing
View Details
Carbetocin Impurity 5 (β-Asp5)
RM-C010505-04 100 mg

Carbetocin Impurity 5 (β-Asp5)

Sign In for Pricing
View Details
Lentiviral mouse Vmn1r221 shRNA (UAS) - Lentiviral mouseVmn1r221 shRNA (UAS, GFP) (25)
GTR15158552 1 Vial

Lentiviral mouse Vmn1r221 shRNA (UAS) - Lentiviral mouseVmn1r221 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details