Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-15, Rat (His)

The GDF-15 protein regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. Binds to its receptor GFRAL and activates GFRAL-expressing neurons in the brainstem, triggering the "stress response circuit." GDF-15 Protein, Rat (His) is the recombinant rat-derived GDF-15 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

GDF-15 Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-15-protein-rat-his.html

Purity

95.00

Smiles

SAHLHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHALIKARLHGLQPDRVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVAQGCHCA

Molecular Formula

29455 (Gene_ID) Q9Z0J6 (S189-A303) (Accession)

Molecular Weight

15-17 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NEI3 (NEIL3) Human Gene Knockout Kit (CRISPR)
KN406838 1 Kit

NEI3 (NEIL3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NYREN18, NT (NEDD8 Ultimate Buster-1, NUB1, Negative Regulator Of Ubiquitin-like Proteins 1, Renal Carcinoma Antigen NY-REN-18, NUB1) (FITC)
MBS6490873-01 0.2 mL

NYREN18, NT (NEDD8 Ultimate Buster-1, NUB1, Negative Regulator Of Ubiquitin-like Proteins 1, Renal Carcinoma Antigen NY-REN-18, NUB1) (FITC)

Sign In for Pricing
View Details
NYREN18, NT (NEDD8 Ultimate Buster-1, NUB1, Negative Regulator Of Ubiquitin-like Proteins 1, Renal Carcinoma Antigen NY-REN-18, NUB1) (FITC)
MBS6490873-02 5x 0.2 mL

NYREN18, NT (NEDD8 Ultimate Buster-1, NUB1, Negative Regulator Of Ubiquitin-like Proteins 1, Renal Carcinoma Antigen NY-REN-18, NUB1) (FITC)

Sign In for Pricing
View Details
CGRP Rabbit pAb
E45R25901N-100 100 µL

CGRP Rabbit pAb

Sign In for Pricing
View Details
CDCA4 Antibody
MBS7128735-01 0.05 mL

CDCA4 Antibody

Sign In for Pricing
View Details
CDCA4 Antibody
MBS7128735-02 0.1 mL

CDCA4 Antibody

Sign In for Pricing
View Details