Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-15, Rat (His)

The GDF-15 protein regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. Binds to its receptor GFRAL and activates GFRAL-expressing neurons in the brainstem, triggering the "stress response circuit." GDF-15 Protein, Rat (His) is the recombinant rat-derived GDF-15 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

GDF-15 Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-15-protein-rat-his.html

Purity

95.00

Smiles

SAHLHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHALIKARLHGLQPDRVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVAQGCHCA

Molecular Formula

29455 (Gene_ID) Q9Z0J6 (S189-A303) (Accession)

Molecular Weight

15-17 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Placenta Growth Factor (PLGF) Antibody
abx455452-01 50 µg

Placenta Growth Factor (PLGF) Antibody

Sign In for Pricing
View Details
Placenta Growth Factor (PLGF) Antibody
abx455452-02 100 µg

Placenta Growth Factor (PLGF) Antibody

Sign In for Pricing
View Details
Pro-PAGE Plus Silver 12%
21462010-1 500 mL

Pro-PAGE Plus Silver 12%

Sign In for Pricing
View Details
pEnCMV-EGFP-2×Linker-NR1I3-SV40-Neo Plasmid
PVT41194 2 µg

pEnCMV-EGFP-2×Linker-NR1I3-SV40-Neo Plasmid

Sign In for Pricing
View Details
Atopobium vaginae PCR kit
PCR-H665-96D 100T

Atopobium vaginae PCR kit

Sign In for Pricing
View Details
Hsa-miR-181d-3p inhibitor
HY-RI00335-01 5 nmol

Hsa-miR-181d-3p inhibitor

Sign In for Pricing
View Details