Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-15, Rat (His)

The GDF-15 protein regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. Binds to its receptor GFRAL and activates GFRAL-expressing neurons in the brainstem, triggering the "stress response circuit." GDF-15 Protein, Rat (His) is the recombinant rat-derived GDF-15 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

GDF-15 Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-15-protein-rat-his.html

Purity

95.00

Smiles

SAHLHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHALIKARLHGLQPDRVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVAQGCHCA

Molecular Formula

29455 (Gene_ID) Q9Z0J6 (S189-A303) (Accession)

Molecular Weight

15-17 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal KLK3 / PSA Antibody (clone 1A7), Clone: 1A7
AMM04360G 0.05mg

Monoclonal KLK3 / PSA Antibody (clone 1A7), Clone: 1A7

Sign In for Pricing
View Details
CstF-50 Antibody
MBS8581791-01 0.1 mL

CstF-50 Antibody

Sign In for Pricing
View Details
CstF-50 Antibody
MBS8581791-02 0.1 mL (AF635)

CstF-50 Antibody

Sign In for Pricing
View Details
CstF-50 Antibody
MBS8581791-03 0.1 mL (AF610)

CstF-50 Antibody

Sign In for Pricing
View Details
CstF-50 Antibody
MBS8581791-04 0.1 mL (AF405S)

CstF-50 Antibody

Sign In for Pricing
View Details
CstF-50 Antibody
MBS8581791-05 0.1 mL (AF405L)

CstF-50 Antibody

Sign In for Pricing
View Details