Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-15, Rat (His)

The GDF-15 protein regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. Binds to its receptor GFRAL and activates GFRAL-expressing neurons in the brainstem, triggering the "stress response circuit." GDF-15 Protein, Rat (His) is the recombinant rat-derived GDF-15 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

GDF-15 Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-15-protein-rat-his.html

Purity

95.00

Smiles

SAHLHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHALIKARLHGLQPDRVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVAQGCHCA

Molecular Formula

29455 (Gene_ID) Q9Z0J6 (S189-A303) (Accession)

Molecular Weight

15-17 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCHE (12S11) Rabbit Monoclonal Antibody
AMRe07492-01 50 µL

BCHE (12S11) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
BCHE (12S11) Rabbit Monoclonal Antibody
AMRe07492-02 100 µL

BCHE (12S11) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
BCHE (12S11) Rabbit Monoclonal Antibody
AMRe07492-03 200 µL

BCHE (12S11) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
TIAL1 Antibody, Biotin conjugated
A36586-50UL 50 μL

TIAL1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
FGFR4 sgRNA CRISPR Lentivector (Human) (Target 1)
K0780302 1.0 µg DNA

FGFR4 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
MANBAL Protein Vector (Human) (pPB-C-His)
PV024937 500 ng

MANBAL Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details