Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-15, Rat (His)

The GDF-15 protein regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. Binds to its receptor GFRAL and activates GFRAL-expressing neurons in the brainstem, triggering the "stress response circuit." GDF-15 Protein, Rat (His) is the recombinant rat-derived GDF-15 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

GDF-15 Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-15-protein-rat-his.html

Purity

95.00

Smiles

SAHLHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHALIKARLHGLQPDRVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVAQGCHCA

Molecular Formula

29455 (Gene_ID) Q9Z0J6 (S189-A303) (Accession)

Molecular Weight

15-17 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SARS-CoV-2 ORF6 Rabbit pAb (APR29081N)
APR29081N-01 50 µL

SARS-CoV-2 ORF6 Rabbit pAb (APR29081N)

Sign In for Pricing
View Details
SARS-CoV-2 ORF6 Rabbit pAb (APR29081N)
APR29081N-02 100 µL

SARS-CoV-2 ORF6 Rabbit pAb (APR29081N)

Sign In for Pricing
View Details
SARS-CoV-2 ORF6 Rabbit pAb (APR29081N)
APR29081N-03 200 µL

SARS-CoV-2 ORF6 Rabbit pAb (APR29081N)

Sign In for Pricing
View Details
S100A11 CRISPR All-in-one AAV vector set (with saCas9)(Human)
42925151 3x 1.0 µg DNA

S100A11 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Bilirubin Oxidase ex. Myrothecium, 1.2U/mg powder
66915 25 Units

Bilirubin Oxidase ex. Myrothecium, 1.2U/mg powder

Sign In for Pricing
View Details
Epsin 1 discontinued
388817 200 µL

Epsin 1 discontinued

Sign In for Pricing
View Details