Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-15, Rat (His)

The GDF-15 protein regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. Binds to its receptor GFRAL and activates GFRAL-expressing neurons in the brainstem, triggering the "stress response circuit." GDF-15 Protein, Rat (His) is the recombinant rat-derived GDF-15 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

GDF-15 Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-15-protein-rat-his.html

Purity

95.00

Smiles

SAHLHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHALIKARLHGLQPDRVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVAQGCHCA

Molecular Formula

29455 (Gene_ID) Q9Z0J6 (S189-A303) (Accession)

Molecular Weight

15-17 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Prim2 Pre-designed siRNA Set B
SI111128B 1 Each

Mouse Prim2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Zmym3 3'UTR GFP Stable Cell Line
TU273886 1.0 mL

Zmym3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Prohibitin Antibody
DF7600-01 100 µL

Prohibitin Antibody

Sign In for Pricing
View Details
Prohibitin Antibody
DF7600-02 200 µL

Prohibitin Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal FRMD6 Antibody
NBP3-05019-20ul 20 µL

Rabbit Polyclonal FRMD6 Antibody

Sign In for Pricing
View Details
GLI3 (GLI-Kruppel Family Member GLI3, ACLS, GCPS, PAP-A, PAPA, PAPA1, PAPB, PHS, PPDIV) (MaxLight 550)
MBS6217120-01 0.1 mL

GLI3 (GLI-Kruppel Family Member GLI3, ACLS, GCPS, PAP-A, PAPA, PAPA1, PAPB, PHS, PPDIV) (MaxLight 550)

Sign In for Pricing
View Details