Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-15, Rat (His)

The GDF-15 protein regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. Binds to its receptor GFRAL and activates GFRAL-expressing neurons in the brainstem, triggering the "stress response circuit." GDF-15 Protein, Rat (His) is the recombinant rat-derived GDF-15 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

GDF-15 Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-15-protein-rat-his.html

Purity

95.00

Smiles

SAHLHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHALIKARLHGLQPDRVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVAQGCHCA

Molecular Formula

29455 (Gene_ID) Q9Z0J6 (S189-A303) (Accession)

Molecular Weight

15-17 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MFSD10 siRNA
abx924050-01 15 nmol

Human MFSD10 siRNA

Sign In for Pricing
View Details
Human MFSD10 siRNA
abx924050-02 30 nmol

Human MFSD10 siRNA

Sign In for Pricing
View Details
Osbpl11 (NM_176840) Mouse Tagged Lenti ORF Clone
MR210492L4 10 µg

Osbpl11 (NM_176840) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Tbc1d10c (NM_001081980) Rat Tagged ORF Clone Lentiviral Particle
RR214777L3V 200 µL

Tbc1d10c (NM_001081980) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Edem1 3'UTR GFP Stable Cell Line
TU253776 1.0 mL

Edem1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Mouse CD14 ELISA Kit
SEKM-0192-01 48 Tests

Mouse CD14 ELISA Kit

Sign In for Pricing
View Details