Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-15, Rat (His)

The GDF-15 protein regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. Binds to its receptor GFRAL and activates GFRAL-expressing neurons in the brainstem, triggering the "stress response circuit." GDF-15 Protein, Rat (His) is the recombinant rat-derived GDF-15 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

GDF-15 Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-15-protein-rat-his.html

Purity

95.00

Smiles

SAHLHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHALIKARLHGLQPDRVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVAQGCHCA

Molecular Formula

29455 (Gene_ID) Q9Z0J6 (S189-A303) (Accession)

Molecular Weight

15-17 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAM23 antibody
70R-50639 100 ul

ADAM23 antibody

Sign In for Pricing
View Details
Hemorrhagic Fever Renal Syndrome (HFRS) Antibody (Hanta Strain)
GWB-T00274 1 mg

Hemorrhagic Fever Renal Syndrome (HFRS) Antibody (Hanta Strain)

Sign In for Pricing
View Details
Rabbit Polyclonal CAT1 Antibody [Alexa Fluor 700]
NBP2-32271AF700 0.1 mL

Rabbit Polyclonal CAT1 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
Anti-CCR4/CD194 Antibody (Mogamulizumab)
F1116-50 50 mg

Anti-CCR4/CD194 Antibody (Mogamulizumab)

Sign In for Pricing
View Details
SLC6A18 siRNA (Human)
MBS8206594-01 15 nmol

SLC6A18 siRNA (Human)

Sign In for Pricing
View Details
SLC6A18 siRNA (Human)
MBS8206594-02 30 nmol

SLC6A18 siRNA (Human)

Sign In for Pricing
View Details