Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-15, Rat (His)

The GDF-15 protein regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. Binds to its receptor GFRAL and activates GFRAL-expressing neurons in the brainstem, triggering the "stress response circuit." GDF-15 Protein, Rat (His) is the recombinant rat-derived GDF-15 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

GDF-15 Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-15-protein-rat-his.html

Purity

95.00

Smiles

SAHLHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHALIKARLHGLQPDRVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVAQGCHCA

Molecular Formula

29455 (Gene_ID) Q9Z0J6 (S189-A303) (Accession)

Molecular Weight

15-17 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prostein (SLC45A3) Rabbit Monoclonal Antibody [Clone ID: RM426]
TA398596 100 µL

Prostein (SLC45A3) Rabbit Monoclonal Antibody [Clone ID: RM426]

Sign In for Pricing
View Details
Mouse Scrn3 activation kit by CRISPRa
GA209960 1 Kit

Mouse Scrn3 activation kit by CRISPRa

Sign In for Pricing
View Details
Rabbit Polyclonal Smad3 [p Ser423 p Ser425] Antibody [Alexa Fluor 647]
NBP1-77836AF647 0.1 mL

Rabbit Polyclonal Smad3 [p Ser423 p Ser425] Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
FKBP1B Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV671909 1.0 µg DNA

FKBP1B Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Porcine desmogleins 1, Dsg-1 ELISA Kit
MBS9305426-01 48 Well

Porcine desmogleins 1, Dsg-1 ELISA Kit

Sign In for Pricing
View Details
Porcine desmogleins 1, Dsg-1 ELISA Kit
MBS9305426-02 96 Well

Porcine desmogleins 1, Dsg-1 ELISA Kit

Sign In for Pricing
View Details