Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-15, Rat (His)

The GDF-15 protein regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. Binds to its receptor GFRAL and activates GFRAL-expressing neurons in the brainstem, triggering the "stress response circuit." GDF-15 Protein, Rat (His) is the recombinant rat-derived GDF-15 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

GDF-15 Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-15-protein-rat-his.html

Purity

95.00

Smiles

SAHLHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHALIKARLHGLQPDRVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVAQGCHCA

Molecular Formula

29455 (Gene_ID) Q9Z0J6 (S189-A303) (Accession)

Molecular Weight

15-17 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HDHD3 siRNA (Human)
CRJ3088-01 15 nmol

HDHD3 siRNA (Human)

Sign In for Pricing
View Details
HDHD3 siRNA (Human)
CRJ3088-02 30 nmol

HDHD3 siRNA (Human)

Sign In for Pricing
View Details
Mouse Tcl1 qPCR Primer Pair
QM05398S 200 Tests

Mouse Tcl1 qPCR Primer Pair

Sign In for Pricing
View Details
BLM Rabbit Polyclonal Antibody
TA397521 100 µg

BLM Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Vascular Endothelial Growth Factor Receptor 2 (VEGFR2) ELISA Kit
MBS4503312-01 48 Tests

Mouse Vascular Endothelial Growth Factor Receptor 2 (VEGFR2) ELISA Kit

Sign In for Pricing
View Details
Mouse Vascular Endothelial Growth Factor Receptor 2 (VEGFR2) ELISA Kit
MBS4503312-02 96 Tests

Mouse Vascular Endothelial Growth Factor Receptor 2 (VEGFR2) ELISA Kit

Sign In for Pricing
View Details