Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-15, Rat (His)

The GDF-15 protein regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. Binds to its receptor GFRAL and activates GFRAL-expressing neurons in the brainstem, triggering the "stress response circuit." GDF-15 Protein, Rat (His) is the recombinant rat-derived GDF-15 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

GDF-15 Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-15-protein-rat-his.html

Purity

95.00

Smiles

SAHLHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHALIKARLHGLQPDRVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVAQGCHCA

Molecular Formula

29455 (Gene_ID) Q9Z0J6 (S189-A303) (Accession)

Molecular Weight

15-17 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDE5A Rabbit Polyclonal Antibody
TA358387 100 µL

PDE5A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal LST1 Antibody (LST1/02) [DyLight 405]
NBP1-45072V 0.1 mL

Mouse Monoclonal LST1 Antibody (LST1/02) [DyLight 405]

Sign In for Pricing
View Details
Human ADAM17 Protein (Pro 18-Asp 563) [His] (NP_064702)
VAng-0709Lsx-500g 500 µg

Human ADAM17 Protein (Pro 18-Asp 563) [His] (NP_064702)

Sign In for Pricing
View Details
RPL26P34 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV779039 1.0 µg DNA

RPL26P34 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
C17orf85 (NCBP3) (NM_018553) Human Recombinant Protein
PH36736M5 20 µg

C17orf85 (NCBP3) (NM_018553) Human Recombinant Protein

Sign In for Pricing
View Details
Rabbit Polyclonal SPECC1L Antibody [DyLight 755]
NBP2-98024IR 0.1 mL

Rabbit Polyclonal SPECC1L Antibody [DyLight 755]

Sign In for Pricing
View Details