Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-15, Rat (His)

The GDF-15 protein regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. Binds to its receptor GFRAL and activates GFRAL-expressing neurons in the brainstem, triggering the "stress response circuit." GDF-15 Protein, Rat (His) is the recombinant rat-derived GDF-15 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

GDF-15 Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-15-protein-rat-his.html

Purity

95.00

Smiles

SAHLHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHALIKARLHGLQPDRVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVAQGCHCA

Molecular Formula

29455 (Gene_ID) Q9Z0J6 (S189-A303) (Accession)

Molecular Weight

15-17 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Keratinocyte-associated protein 3 (Krtcap3), partial
MBS7092865 Inquire

Recombinant Mouse Keratinocyte-associated protein 3 (Krtcap3), partial

Sign In for Pricing
View Details
Putative Aspartate Aminotransferase, Cytoplasmic 2 (GOT1L1) Antibody
abx026452-01 80 µL

Putative Aspartate Aminotransferase, Cytoplasmic 2 (GOT1L1) Antibody

Sign In for Pricing
View Details
Putative Aspartate Aminotransferase, Cytoplasmic 2 (GOT1L1) Antibody
abx026452-02 400 µL

Putative Aspartate Aminotransferase, Cytoplasmic 2 (GOT1L1) Antibody

Sign In for Pricing
View Details
Krtdap (NM_001033131) Mouse Tagged ORF Clone Lentiviral Particle
MR225130L3V 200 µL

Krtdap (NM_001033131) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
IL27 (Interleukin 27, IL-27, IL-27A, IL27p28, IL30, MGC71873, p28)
247578 100 µg

IL27 (Interleukin 27, IL-27, IL-27A, IL27p28, IL30, MGC71873, p28)

Sign In for Pricing
View Details
Anti-HA-tag Mouse mAb
MBS8533161-01 0.1 mL

Anti-HA-tag Mouse mAb

Sign In for Pricing
View Details