Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-15, Rat (His)

The GDF-15 protein regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. Binds to its receptor GFRAL and activates GFRAL-expressing neurons in the brainstem, triggering the "stress response circuit." GDF-15 Protein, Rat (His) is the recombinant rat-derived GDF-15 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

GDF-15 Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-15-protein-rat-his.html

Purity

95.00

Smiles

SAHLHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHALIKARLHGLQPDRVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVAQGCHCA

Molecular Formula

29455 (Gene_ID) Q9Z0J6 (S189-A303) (Accession)

Molecular Weight

15-17 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR26 ORF Vector (Human) (pORF)
ORF020372 1.0 µg DNA

GPR26 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
PDCD2 (NM_144781) Human Tagged Lenti ORF Clone
RC212258L3 10 µg

PDCD2 (NM_144781) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Ss18 (BC096742) Mouse Tagged Lenti ORF Clone
MR206052L4 10 µg

Ss18 (BC096742) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TFF3 AAV siRNA Pooled Vector
46575161 1.0 µg

TFF3 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
SHH antibody
70R-13756 100 ug

SHH antibody

Sign In for Pricing
View Details
1,3-Dibenzylurea
411014-01 500 mg

1,3-Dibenzylurea

Sign In for Pricing
View Details