Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-17A, Mouse (CHO)

IL-17A is a homodimeric cytokine and plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides, cytokines, chemokines, and matrix metalloproteinases[1][2]. IL-17A Protein, Mouse (CHO) is a recombinant mouse IL-17A protein and is expressed in CHO cells. It consists of 133 amino acids (A26-A158) .

Product Specifications

Product Name Alternative

IL-17A Protein, Mouse (CHO), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-17a-protein-mouse-cho.html

Purity

96.00

Smiles

AAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA

Molecular Formula

16171 (Gene_ID) Q62386 (A26-A158) (Accession)

Molecular Weight

Approximately 15-22 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Chen K, et al. Interluekin-17A (IL17A) . Gene. 2017 May 30;614:8-14.|[2]Iwakura Y, et al. The roles of IL-17A in inflammatory immune responses and host defense against pathogens. Immunol Rev. 2008 Dec;226:57-79.|[3]Cua DJ, et al. Innate IL-17-producing cells: the sentinels of the immune system. Nat Rev Immunol. 2010 Jul;10 (7) :479-89.|[4]Wright JF, et al. The human IL-17F/IL-17A heterodimeric cytokine signals through the IL-17RA/IL-17RC receptor complex. J Immunol. 2008 Aug 15;181 (4) :2799-805.|[5]Pelidou SH, et al. Enhancement of acute phase and inhibition of chronic phase of experimental autoimmune neuritis in Lewis rats by intranasal administration of recombinant mouse interleukin 17: potential immunoregulatory role. Exp Neurol. 2000 May;163 (1) :165-72.|[6]Liu Y, et al. IL-17A and TNF-α exert synergistic effects on expression of CXCL5 by alveolar type II cells in vivo and in vitro. J Immunol. 2011 Mar 1;186 (5) :3197-205.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNG4 Rabbit Polyclonal Antibody
HA500259 100 µL

GNG4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HSPA5 Polyclonal Antibody
E-AB-70042-01 60 µL

HSPA5 Polyclonal Antibody

Sign In for Pricing
View Details
HSPA5 Polyclonal Antibody
E-AB-70042-02 120 µL

HSPA5 Polyclonal Antibody

Sign In for Pricing
View Details
HSPA5 Polyclonal Antibody
E-AB-70042-03 200 µL

HSPA5 Polyclonal Antibody

Sign In for Pricing
View Details
Rgs2 Mouse Gene Knockout Kit (CRISPR)
KN514736 1 Kit

Rgs2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DAO Sheep Polyclonal Antibody
TA397078S 25 µL

DAO Sheep Polyclonal Antibody

Sign In for Pricing
View Details