Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Apoptosis regulator Bcl-2 (Bcl2), partial

Product Specifications

Abbreviation

Recombinant Mouse Bcl2 protein, partial

Gene Name

Bcl2

UniProt

P10417

Expression Region

5-205aa

Organism

Mus musculus (Mouse)

Target Sequence

GRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRP

Tag

Tag-Free

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Suppresses apoptosis in a variety of cell systs including factor-dependent lymphohatopoietic and neural cells. Regulates cell death by controlling the mitochondrial mbrane permeability. Appears to function in a feedback loop syst with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

22.8 kDa

References & Citations

Apoptosis factor EI24/PIG8 is a novel endoplasmic reticulum-localized Bcl-2-binding protein which is associated with suppression of breast cancer invasiveness.Zhao X., Ayer R.E., Davis S.L., Ames S.J., Florence B., Torchinsky C., Liou J.S., Shen L., Spanjaard R.A.Cancer Res. 65:2125-2129 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MC1R (Melanocortin Receptor 1, CMM5, MSH-R, SHEP2) discontinued
211932-01 50 µL

MC1R (Melanocortin Receptor 1, CMM5, MSH-R, SHEP2) discontinued

Sign In for Pricing
View Details
MC1R (Melanocortin Receptor 1, CMM5, MSH-R, SHEP2) discontinued
211932-02 100 µL

MC1R (Melanocortin Receptor 1, CMM5, MSH-R, SHEP2) discontinued

Sign In for Pricing
View Details
MC1R (Melanocortin Receptor 1, CMM5, MSH-R, SHEP2) discontinued
211932-03 200 µL

MC1R (Melanocortin Receptor 1, CMM5, MSH-R, SHEP2) discontinued

Sign In for Pricing
View Details
DNL4 Antibody
MBS9413398-01 0.05 mL

DNL4 Antibody

Sign In for Pricing
View Details
DNL4 Antibody
MBS9413398-02 0.1 mL

DNL4 Antibody

Sign In for Pricing
View Details
DNL4 Antibody
MBS9413398-03 5x 0.1 mL

DNL4 Antibody

Sign In for Pricing
View Details