Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Feline CCL17 protein

The Feline CCL17 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline CCL17 applications are for cell culture, ELISA standard, and Western Blot Control. Feline CCL17 yeast-derived recombinant protein can be purchased in multiple sizes. Feline CCL17 Specifications: (Molecular Weight: 16.9 kDa) (Amino Acid Sequence: VLSGALCFRM KDAELKVLYL HDNQLLAGRL HAGNIIQGEE ISVVPNRSLD AKLSPVILGV QGGSQCLSCG TGQEPTLKLE PVNIMELYLG AKESKSFTFY RRDTGLTSSF ESAAYPGWFL CTVPEADQPL RLTQLSEDAS WDSPITDFYF QQCD (154) ) (Gene ID: 101097230) .

Product Specifications

Source

Yeast

Origin

Feline

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

8.5 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

ARATNVGRECCLEYFKGAIPLRRLTGWYRTSGECSKDAIVFVTIHGKSICSDPKDTRVKKTVRYLQSIMNPVPQE (75)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp865 Mouse Gene Knockout Kit (CRISPR)
KN520008 1 Kit

Zfp865 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
5-Carboxy-N-phenyl-2-1H-pyridone, Sodium Salt
TRC-C179023-10MG 10 mg

5-Carboxy-N-phenyl-2-1H-pyridone, Sodium Salt

Sign In for Pricing
View Details
Histone Deacetylase (HDAC) Activity Fluorometric Assay Kit
E-BC-F051 96 T (40 samples)

Histone Deacetylase (HDAC) Activity Fluorometric Assay Kit

Sign In for Pricing
View Details
Renal Cell Carcinoma (Carbonic Anhydrase IX) (PN-15), 0.2mg/mL
BNUB0637-100 1x 100 µL

Renal Cell Carcinoma (Carbonic Anhydrase IX) (PN-15), 0.2mg/mL

Sign In for Pricing
View Details
APAF1 (N-term) Rabbit Polyclonal Antibody
AP23392PU-N 100 µg

APAF1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human AMOTL2 activation kit by CRISPRa
GA109795 1 Kit

Human AMOTL2 activation kit by CRISPRa

Sign In for Pricing
View Details