Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Feline CCL17 protein

The Feline CCL17 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline CCL17 applications are for cell culture, ELISA standard, and Western Blot Control. Feline CCL17 yeast-derived recombinant protein can be purchased in multiple sizes. Feline CCL17 Specifications: (Molecular Weight: 16.9 kDa) (Amino Acid Sequence: VLSGALCFRM KDAELKVLYL HDNQLLAGRL HAGNIIQGEE ISVVPNRSLD AKLSPVILGV QGGSQCLSCG TGQEPTLKLE PVNIMELYLG AKESKSFTFY RRDTGLTSSF ESAAYPGWFL CTVPEADQPL RLTQLSEDAS WDSPITDFYF QQCD (154) ) (Gene ID: 101097230) .

Product Specifications

Source

Yeast

Origin

Feline

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

8.5 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

ARATNVGRECCLEYFKGAIPLRRLTGWYRTSGECSKDAIVFVTIHGKSICSDPKDTRVKKTVRYLQSIMNPVPQE (75)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIP1 Antibody
KC-692-01 50 μL

HIP1 Antibody

Sign In for Pricing
View Details
HIP1 Antibody
KC-692-02 100 µL

HIP1 Antibody

Sign In for Pricing
View Details
HIP1 Antibody
KC-692-03 1 mL

HIP1 Antibody

Sign In for Pricing
View Details
Thyroid Stimulating Hormone, beta (TSH beta) (Pituitary Marker) (TSHb/1317), CF488A conjugate, 0.1mg/mL
BNC881317-100 1x 100 µL

Thyroid Stimulating Hormone, beta (TSH beta) (Pituitary Marker) (TSHb/1317), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD50 Antibody[CBR-IC3/1]
AN00318L-01 20 Tests

Elab Fluor® 488 Anti-Human CD50 Antibody[CBR-IC3/1]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD50 Antibody[CBR-IC3/1]
AN00318L-02 100 Tests

Elab Fluor® 488 Anti-Human CD50 Antibody[CBR-IC3/1]

Sign In for Pricing
View Details