Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-8/CXCL8, Human

Interleukin-8 (IL-8), also known as CXCL8 or NAP-1, is a pro-inflammatory CXC chemokine. IL-8 acts on human neutrophils via two receptors, CXCR1 and CXCR2. IL-8 has a conserved Glu-Leu-Arg (ELR) N-terminal motif, and is an agonist for CXCR1/CXCR2. IL-8 is produced by various cells including leukocytes, endothelial cells, and epithelial cells[1][2][3]. IL-8/CXCL8 Protein, Human is produced in E.coil.

Product Specifications

Product Name Alternative

IL-8/CXCL8 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-8-cxcl8-protein-human-77a-a.html

Purity

98.0

Smiles

AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

Molecular Formula

3576 (Gene_ID) P10145 (A23-S99) (Accession)

Molecular Weight

Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Baggiolini M, et al. Neutrophil-activating peptide-1/interleukin 8, a novel cytokine that activates neutrophils. J Clin Invest. 1989 Oct;84 (4) :1045-9.|[2]Koch AE, et al. Interleukin-8 as a macrophage-derived mediator of angiogenesis. Science. 1992 Dec 11;258 (5089) :1798-801.|[3]M Baggiolini, et al. Neutrophil-activating peptide-1/interleukin 8, a novel cytokine that activates neutrophils. J Clin Invest. 1989 Oct;84 (4) :1045-9.|[4]M Wolf, et al. Granulocyte chemotactic protein 2 acts via both IL-8 receptors, CXCR1 and CXCR2. Eur J Immunol. 1998 Jan;28 (1) :164-70.|[5]Qian Liu, et al. The CXCL8-CXCR1/2 pathways in cancer. Cytokine Growth Factor Rev. 2016 Oct;31:61-71.|[6]Jian-Feng Liu, et al. IL-8 Is Upregulated in the Tissue-Derived EVs of Odontogenic Keratocysts. Biomed Res Int. 2022 Jul 30;2022:9453270.|[7]Remo C Russo, et al. The CXCL8/IL-8 chemokine family and its receptors in inflammatory diseases. Expert Rev Clin Immunol. 2014 May;10 (5) :593-619.|[8]Hai Jiang, et al. CXCL8 promotes the invasion of human osteosarcoma cells by regulation of PI3K/Akt signaling pathway. APMIS. 2017 Sep;125 (9) :773-780.|[9]L Laterveer, et al. Rapid mobilization of hematopoietic progenitor cells in rhesus monkeys by a single intravenous injection of interleukin-8. Blood. 1996 Jan 15;87 (2) :781-8.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Yod1 Mouse siRNA Oligo Duplex (Locus ID 226418)
SR408840 1 Kit

Yod1 Mouse siRNA Oligo Duplex (Locus ID 226418)

Sign In for Pricing
View Details
Human Synaptotagmin Like Protein 2 (SYTL2) ELISA Kit
EK16795 48 Tests

Human Synaptotagmin Like Protein 2 (SYTL2) ELISA Kit

Sign In for Pricing
View Details
Mouse Cdk5 Pre-designed siRNA Set A
SI102272A 1 Each

Mouse Cdk5 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Reg3d Mouse shRNA Plasmid (Locus ID 30053)
TR502774 1 Kit

Reg3d Mouse shRNA Plasmid (Locus ID 30053)

Sign In for Pricing
View Details
Antithrombin (FITC)
545172 200 µL

Antithrombin (FITC)

Sign In for Pricing
View Details
SERPINB4 Rabbit Polyclonal Antibody (Cy5)
orb888072 100 µL

SERPINB4 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details