Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Growth-regulated alpha protein (CXCL1) (Active)

Product Specifications

Product Name Alternative

C-X-C motif chemokine 1 Melanoma growth stimulatory activity, MGSA, Neutrophil-activating protein 3

Abbreviation

Recombinant Human CXCL1 protein (Active)

Gene Name

CXCL1

UniProt

P09341

Expression Region

35-107aa

Organism

Homo sapiens (Human)

Target Sequence

ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.Coli

Field of Research

Immunology

Relevance

Has chemotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO-alpha (4-73), GRO-alpha (5-73) and GRO-alpha (6-73) show a 30-fold higher chemotactic activity. {ECO:0000269|PubMed:10095777}.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

>97% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood neutrophils is in a concentration range of 10-50 ng/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered concentrated solution in 20 mM PB, pH 7.4, 50 mM NaCl.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Has chemotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO-alpha (4-73), GRO-alpha (5-73) and GRO-alpha (6-73) show a 30-fold higher chemotactic activity.

Molecular Weight

7.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Histone H4 (Mono Methyl Lys12) Monoclonal Antibody
AN302114L-01 50 µL

Recombinant Histone H4 (Mono Methyl Lys12) Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Histone H4 (Mono Methyl Lys12) Monoclonal Antibody
AN302114L-02 100 µL

Recombinant Histone H4 (Mono Methyl Lys12) Monoclonal Antibody

Sign In for Pricing
View Details
Cooled Incubator BICL-7902
BICL-7902 1 Unit

Cooled Incubator BICL-7902

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Mouse CD24 Antibody[M1/69]
E-AB-F1179Q-01 50 Tests

Elab Fluor® Violet 450 Anti-Mouse CD24 Antibody[M1/69]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Mouse CD24 Antibody[M1/69]
E-AB-F1179Q-02 100 Tests

Elab Fluor® Violet 450 Anti-Mouse CD24 Antibody[M1/69]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Mouse CD24 Antibody[M1/69]
E-AB-F1179Q-03 2x 100 Tests

Elab Fluor® Violet 450 Anti-Mouse CD24 Antibody[M1/69]

Sign In for Pricing
View Details