Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JAM-A/CD321, Rat (HEK293, His)

The JAM-A/CD321 protein is critical for the formation of tight junctions in epithelial cells, participating in early junction development and recruiting PARD3. However, the formation of PARD6-PARD3 complex may hinder PARD3-JAM1 interaction, thus preventing tight junction assembly. JAM-A/CD321 Protein, Rat (HEK293, His) is the recombinant rat-derived JAM-A/CD321 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

JAM-A/CD321 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/jam-a-cd321-protein-rat-hek293-his.html

Purity

96.0

Smiles

KGSVYSPQTAVQVPENDSVKLPCIYSGFSSPRVEWKFVQGSTTALVCYNNQITVPYADRVTFSSSGITFSSVTRKDNGEYTCMVSEDGGQNYGEVSIHLTVLVPPSKPTVSIPSSVTIGNRAVLTCSEHDGSPPSEYSWFKDGVPMLTADAKKTRAFINSSYTIDPKSGDLVFDPVSAFDSGEYYCEAQNGYGTAMRSEAVRMEAVELNVGG

Molecular Formula

116479 (Gene_ID) Q9JHY1 (K27-G238) (Accession)

Molecular Weight

Approximately 25&28 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nicotinic Acetylcholine Receptor alpha 5 Rabbit mAb
E2R389203 100 µL

Nicotinic Acetylcholine Receptor alpha 5 Rabbit mAb

Sign In for Pricing
View Details
UBE2F siRNA (h)
sc-94988 10 µM

UBE2F siRNA (h)

Sign In for Pricing
View Details
OPRM1 discontinued
392599-01 20 µL

OPRM1 discontinued

Sign In for Pricing
View Details
OPRM1 discontinued
392599-02 200 µL

OPRM1 discontinued

Sign In for Pricing
View Details
KYNU Rabbit pAb, PerCP-Cy7 conjugated
orb2857598 100 µL

KYNU Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
anti-beta Crystallin A3
YF-PA23513 50 ul

anti-beta Crystallin A3

Sign In for Pricing
View Details