Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PILR-alpha, Human (178a.a, HEK293, Fc)

PILR-α is a member of the paired receptor family and functions as an inhibitory signaling receptor in immune regulation. It inhibits signal transduction by recruiting the phosphatases PTPN6/SHP-1 and PTPN11/SHP-2, blocking the phosphorylation of key signaling molecules. PILR-alpha Protein, Human (178a.a, HEK293, Fc) is the recombinant human-derived PILR-alpha protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

PILR-alpha Protein, Human (178a.a, HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pilr-alpha-protein-human-178a-a-hek293-fc.html

Purity

95.00

Smiles

QPSGSTGSGPSYLYGVTQPKHLSASMGGSVEIPFSFYYPWELATAPDVRISWRRGHFHRQSFYSTRPPSIHKDYVNRLFLNWTEGQKSGFLRISNLQKQDQSVYFCRVELDTRSSGRQQWQSIEGTKLSITQAVTTTTQRPSSMTTTWRLSSTTTTTGLRVTQGKRRSDSWHISLETA

Molecular Formula

29992 (Gene_ID) Q9UKJ1-1 (Q20-A197) (Accession)

Molecular Weight

60-70 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PAQR4 activation kit by CRISPRa
GA114832 1 Kit

Human PAQR4 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS500609 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Tnfaip8l1 (NM_025566) Mouse Tagged ORF Clone
MG201731 10 µg

Tnfaip8l1 (NM_025566) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
HLA-DP/-DQ/-DR (MHC II) (CR3/43), 0.2mg/mL
BNUB1656-500 1x 500 µL

HLA-DP/-DQ/-DR (MHC II) (CR3/43), 0.2mg/mL

Sign In for Pricing
View Details
N-Nitrosodabigatran Etexilate
TRC-N344740-2.5MG 2.5 mg

N-Nitrosodabigatran Etexilate

Sign In for Pricing
View Details
TREM1 (NM_018643) Human Over-expression Lysate
LC402700 20 µg

TREM1 (NM_018643) Human Over-expression Lysate

Sign In for Pricing
View Details