Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRP-10, Human (HEK293, His)

The LRP-10 protein is a possible receptor that may mediate internalization and/or signaling of lipophilic molecules.It is speculated that LRP-10 can promote the uptake of lipoprotein APOE in the liver and may play a role in lipid metabolism and processes related to lipoprotein transport.LRP-10 Protein, Human (HEK293, His) is the recombinant human-derived LRP-10 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LRP-10 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lrp-10-protein-human-hek293-his.html

Purity

97.80

Smiles

HPDRIIFPNHACEDPPAVLLEVQGTLQRPLVRDSRTSPANCTWLILGSKEQTVTIRFQKLHLACGSERLTLRSPLQPLISLCEAPPSPLQLPGGNVTITYSYAGARAPMGQGFLLSYSQDWLMCLQEEFQCLNHRCVSAVQRCDGVDACGDGSDEAGCSSDPFPGLTPRPVPSLPCNVTLEDFYGVFSSPGYTHLASVSHPQSCHWLLDPHDGRRLAVRFTALDLGFGDAVHVYDGPGPPESSRLLRSLTHFSNGKAVTVETLSGQAVVSYHTVAWSNGRGFNATYHVRGYCLPWDRPCGLGSGLGAGEGLGERCYSEAQRCDGSWDCADGTDEEDCPGCPPGHFPCGAAGTSGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDGQPDCADGSDEWDCSYVLPRK

Molecular Formula

26020 (Gene_ID) Q7Z4F1-1 (H17-K440) (Accession)

Molecular Weight

Approximately 55 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAP2 Antibody, HRP conjugated
A70897-100UG 100 µg

ADAP2 Antibody, HRP conjugated

Sign In for Pricing
View Details
PPP4C Monoclonal Antibody
A10621-100UL 100 µL

PPP4C Monoclonal Antibody

Sign In for Pricing
View Details
Plant Transforming Growth Factor Receptor (TGFR) ELISA Kit
MBS9373291 Inquire

Plant Transforming Growth Factor Receptor (TGFR) ELISA Kit

Sign In for Pricing
View Details
(2S,3S) -3-Amino-2-[[ (2Z) -2- (2-amino-4-thiazolyl) -2-[ (1-carboxy-1-methylethoxy) imino]acetyl]amino]butanoic Acid Trifluoroacetic Acid Salt
422043-01 1 mg

(2S,3S) -3-Amino-2-[[ (2Z) -2- (2-amino-4-thiazolyl) -2-[ (1-carboxy-1-methylethoxy) imino]acetyl]amino]butanoic Acid Trifluoroacetic Acid Salt

Sign In for Pricing
View Details
(2S,3S) -3-Amino-2-[[ (2Z) -2- (2-amino-4-thiazolyl) -2-[ (1-carboxy-1-methylethoxy) imino]acetyl]amino]butanoic Acid Trifluoroacetic Acid Salt
422043-02 10 mg

(2S,3S) -3-Amino-2-[[ (2Z) -2- (2-amino-4-thiazolyl) -2-[ (1-carboxy-1-methylethoxy) imino]acetyl]amino]butanoic Acid Trifluoroacetic Acid Salt

Sign In for Pricing
View Details
Anti-SGSM3
Y058612 100 µg

Anti-SGSM3

Sign In for Pricing
View Details