Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRP-10, Human (HEK293, His)

The LRP-10 protein is a possible receptor that may mediate internalization and/or signaling of lipophilic molecules.It is speculated that LRP-10 can promote the uptake of lipoprotein APOE in the liver and may play a role in lipid metabolism and processes related to lipoprotein transport.LRP-10 Protein, Human (HEK293, His) is the recombinant human-derived LRP-10 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LRP-10 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lrp-10-protein-human-hek293-his.html

Purity

97.80

Smiles

HPDRIIFPNHACEDPPAVLLEVQGTLQRPLVRDSRTSPANCTWLILGSKEQTVTIRFQKLHLACGSERLTLRSPLQPLISLCEAPPSPLQLPGGNVTITYSYAGARAPMGQGFLLSYSQDWLMCLQEEFQCLNHRCVSAVQRCDGVDACGDGSDEAGCSSDPFPGLTPRPVPSLPCNVTLEDFYGVFSSPGYTHLASVSHPQSCHWLLDPHDGRRLAVRFTALDLGFGDAVHVYDGPGPPESSRLLRSLTHFSNGKAVTVETLSGQAVVSYHTVAWSNGRGFNATYHVRGYCLPWDRPCGLGSGLGAGEGLGERCYSEAQRCDGSWDCADGTDEEDCPGCPPGHFPCGAAGTSGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDGQPDCADGSDEWDCSYVLPRK

Molecular Formula

26020 (Gene_ID) Q7Z4F1-1 (H17-K440) (Accession)

Molecular Weight

Approximately 55 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Genorise® Equine Myeloperoxidase polyclonal antibody
GR105272 100 µg

Genorise® Equine Myeloperoxidase polyclonal antibody

Sign In for Pricing
View Details
ELISA kit for Rat Microtubule-associated protein tau (MAPT)
KTE101166-01 48 Tests

ELISA kit for Rat Microtubule-associated protein tau (MAPT)

Sign In for Pricing
View Details
ELISA kit for Rat Microtubule-associated protein tau (MAPT)
KTE101166-02 96 Tests

ELISA kit for Rat Microtubule-associated protein tau (MAPT)

Sign In for Pricing
View Details
ELISA kit for Rat Microtubule-associated protein tau (MAPT)
KTE101166-03 5x 96 Well

ELISA kit for Rat Microtubule-associated protein tau (MAPT)

Sign In for Pricing
View Details
Olfr138 Protein Vector (Mouse) (pPM-C-His)
PV209165 500 ng

Olfr138 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
CX3CL1/Fractalkine Rabbit anti-Human Polyclonal Antibody
MBS2403632-01 0.05 mL

CX3CL1/Fractalkine Rabbit anti-Human Polyclonal Antibody

Sign In for Pricing
View Details