Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRP-10, Human (HEK293, His)

The LRP-10 protein is a possible receptor that may mediate internalization and/or signaling of lipophilic molecules.It is speculated that LRP-10 can promote the uptake of lipoprotein APOE in the liver and may play a role in lipid metabolism and processes related to lipoprotein transport.LRP-10 Protein, Human (HEK293, His) is the recombinant human-derived LRP-10 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LRP-10 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lrp-10-protein-human-hek293-his.html

Purity

97.80

Smiles

HPDRIIFPNHACEDPPAVLLEVQGTLQRPLVRDSRTSPANCTWLILGSKEQTVTIRFQKLHLACGSERLTLRSPLQPLISLCEAPPSPLQLPGGNVTITYSYAGARAPMGQGFLLSYSQDWLMCLQEEFQCLNHRCVSAVQRCDGVDACGDGSDEAGCSSDPFPGLTPRPVPSLPCNVTLEDFYGVFSSPGYTHLASVSHPQSCHWLLDPHDGRRLAVRFTALDLGFGDAVHVYDGPGPPESSRLLRSLTHFSNGKAVTVETLSGQAVVSYHTVAWSNGRGFNATYHVRGYCLPWDRPCGLGSGLGAGEGLGERCYSEAQRCDGSWDCADGTDEEDCPGCPPGHFPCGAAGTSGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDGQPDCADGSDEWDCSYVLPRK

Molecular Formula

26020 (Gene_ID) Q7Z4F1-1 (H17-K440) (Accession)

Molecular Weight

Approximately 55 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ssbp1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4930108 1.0 µg DNA

Ssbp1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
DIS3 Antibody (Center) Blocking peptide
MBS9217476-01 0.5 mg

DIS3 Antibody (Center) Blocking peptide

Sign In for Pricing
View Details
DIS3 Antibody (Center) Blocking peptide
MBS9217476-02 5x 0.5 mg

DIS3 Antibody (Center) Blocking peptide

Sign In for Pricing
View Details
Cytokeratin 8 (CARD2, CK8, CYK8, CYKER, Cytokeratin Endo A, DreK8, EndoA, K2C8, K8, Keratin 8, Krt 2.8, KRT8, Type-II Keratin Kb8) (BSA & Azide Free) (MaxLight 750)
MBS6236458-01 0.1 mL

Cytokeratin 8 (CARD2, CK8, CYK8, CYKER, Cytokeratin Endo A, DreK8, EndoA, K2C8, K8, Keratin 8, Krt 2.8, KRT8, Type-II Keratin Kb8) (BSA & Azide Free) (MaxLight 750)

Sign In for Pricing
View Details
Cytokeratin 8 (CARD2, CK8, CYK8, CYKER, Cytokeratin Endo A, DreK8, EndoA, K2C8, K8, Keratin 8, Krt 2.8, KRT8, Type-II Keratin Kb8) (BSA & Azide Free) (MaxLight 750)
MBS6236458-02 5x 0.1 mL

Cytokeratin 8 (CARD2, CK8, CYK8, CYKER, Cytokeratin Endo A, DreK8, EndoA, K2C8, K8, Keratin 8, Krt 2.8, KRT8, Type-II Keratin Kb8) (BSA & Azide Free) (MaxLight 750)

Sign In for Pricing
View Details
KLHL31 Protein Vector (Rat) (pPM-C-HA)
PV276480 500 ng

KLHL31 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details