Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRP-10, Human (HEK293, His)

The LRP-10 protein is a possible receptor that may mediate internalization and/or signaling of lipophilic molecules.It is speculated that LRP-10 can promote the uptake of lipoprotein APOE in the liver and may play a role in lipid metabolism and processes related to lipoprotein transport.LRP-10 Protein, Human (HEK293, His) is the recombinant human-derived LRP-10 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LRP-10 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lrp-10-protein-human-hek293-his.html

Purity

97.80

Smiles

HPDRIIFPNHACEDPPAVLLEVQGTLQRPLVRDSRTSPANCTWLILGSKEQTVTIRFQKLHLACGSERLTLRSPLQPLISLCEAPPSPLQLPGGNVTITYSYAGARAPMGQGFLLSYSQDWLMCLQEEFQCLNHRCVSAVQRCDGVDACGDGSDEAGCSSDPFPGLTPRPVPSLPCNVTLEDFYGVFSSPGYTHLASVSHPQSCHWLLDPHDGRRLAVRFTALDLGFGDAVHVYDGPGPPESSRLLRSLTHFSNGKAVTVETLSGQAVVSYHTVAWSNGRGFNATYHVRGYCLPWDRPCGLGSGLGAGEGLGERCYSEAQRCDGSWDCADGTDEEDCPGCPPGHFPCGAAGTSGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDGQPDCADGSDEWDCSYVLPRK

Molecular Formula

26020 (Gene_ID) Q7Z4F1-1 (H17-K440) (Accession)

Molecular Weight

Approximately 55 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DEK Antibody
A19249-100UL 100 µL

DEK Antibody

Sign In for Pricing
View Details
Phospho-GYS1 (S641) Antibody
A22522-100UG 100 µg

Phospho-GYS1 (S641) Antibody

Sign In for Pricing
View Details
Glutaminase (GLS) (NM_014905) Human Tagged ORF Clone Lentiviral Particle
RC206265L1V 200 µL

Glutaminase (GLS) (NM_014905) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human GSDME Pre-designed siRNA Set A
SI006678A 1 Each

Human GSDME Pre-designed siRNA Set A

Sign In for Pricing
View Details
Cacotheline AR
103020 25 25 g

Cacotheline AR

Sign In for Pricing
View Details
FILIP1L CRISPRa sgRNA lentivector (set of three targets)(Human)
20563121 3x 1.0µg DNA

FILIP1L CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details