Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRP-10, Human (HEK293, His)

The LRP-10 protein is a possible receptor that may mediate internalization and/or signaling of lipophilic molecules.It is speculated that LRP-10 can promote the uptake of lipoprotein APOE in the liver and may play a role in lipid metabolism and processes related to lipoprotein transport.LRP-10 Protein, Human (HEK293, His) is the recombinant human-derived LRP-10 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LRP-10 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lrp-10-protein-human-hek293-his.html

Purity

97.80

Smiles

HPDRIIFPNHACEDPPAVLLEVQGTLQRPLVRDSRTSPANCTWLILGSKEQTVTIRFQKLHLACGSERLTLRSPLQPLISLCEAPPSPLQLPGGNVTITYSYAGARAPMGQGFLLSYSQDWLMCLQEEFQCLNHRCVSAVQRCDGVDACGDGSDEAGCSSDPFPGLTPRPVPSLPCNVTLEDFYGVFSSPGYTHLASVSHPQSCHWLLDPHDGRRLAVRFTALDLGFGDAVHVYDGPGPPESSRLLRSLTHFSNGKAVTVETLSGQAVVSYHTVAWSNGRGFNATYHVRGYCLPWDRPCGLGSGLGAGEGLGERCYSEAQRCDGSWDCADGTDEEDCPGCPPGHFPCGAAGTSGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDGQPDCADGSDEWDCSYVLPRK

Molecular Formula

26020 (Gene_ID) Q7Z4F1-1 (H17-K440) (Accession)

Molecular Weight

Approximately 55 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal Jagged 2 Antibody (746513) [DyLight 550]
FAB4748L 0.1 mL

Rat Monoclonal Jagged 2 Antibody (746513) [DyLight 550]

Sign In for Pricing
View Details
Mouse BRCA2 (Breast Cancer Susceptibility Protein 2) ELISA Kit
ELK3269-01 48 Tests

Mouse BRCA2 (Breast Cancer Susceptibility Protein 2) ELISA Kit

Sign In for Pricing
View Details
Mouse BRCA2 (Breast Cancer Susceptibility Protein 2) ELISA Kit
ELK3269-02 96 Tests

Mouse BRCA2 (Breast Cancer Susceptibility Protein 2) ELISA Kit

Sign In for Pricing
View Details
Mouse BRCA2 (Breast Cancer Susceptibility Protein 2) ELISA Kit
ELK3269-03 5x 96 Tests

Mouse BRCA2 (Breast Cancer Susceptibility Protein 2) ELISA Kit

Sign In for Pricing
View Details
RPL19P3 3'UTR Luciferase Stable Cell Line
TU020887 1.0 mL

RPL19P3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
ApoER2 (LRP8) Rabbit Monoclonal Antibody
TA423215 100 µL

ApoER2 (LRP8) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details