Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRP-10, Human (HEK293, His)

The LRP-10 protein is a possible receptor that may mediate internalization and/or signaling of lipophilic molecules.It is speculated that LRP-10 can promote the uptake of lipoprotein APOE in the liver and may play a role in lipid metabolism and processes related to lipoprotein transport.LRP-10 Protein, Human (HEK293, His) is the recombinant human-derived LRP-10 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LRP-10 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lrp-10-protein-human-hek293-his.html

Purity

97.80

Smiles

HPDRIIFPNHACEDPPAVLLEVQGTLQRPLVRDSRTSPANCTWLILGSKEQTVTIRFQKLHLACGSERLTLRSPLQPLISLCEAPPSPLQLPGGNVTITYSYAGARAPMGQGFLLSYSQDWLMCLQEEFQCLNHRCVSAVQRCDGVDACGDGSDEAGCSSDPFPGLTPRPVPSLPCNVTLEDFYGVFSSPGYTHLASVSHPQSCHWLLDPHDGRRLAVRFTALDLGFGDAVHVYDGPGPPESSRLLRSLTHFSNGKAVTVETLSGQAVVSYHTVAWSNGRGFNATYHVRGYCLPWDRPCGLGSGLGAGEGLGERCYSEAQRCDGSWDCADGTDEEDCPGCPPGHFPCGAAGTSGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDGQPDCADGSDEWDCSYVLPRK

Molecular Formula

26020 (Gene_ID) Q7Z4F1-1 (H17-K440) (Accession)

Molecular Weight

Approximately 55 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Thrombospondin 1 (THBS1) ELISA Kit
RD-THBS1-Mu-48Tests 48 Tests

Mouse Thrombospondin 1 (THBS1) ELISA Kit

Sign In for Pricing
View Details
Human RCAN2 Knockout A549 cell line
GTR15411898 1 Vial

Human RCAN2 Knockout A549 cell line

Sign In for Pricing
View Details
Fosclevudine alafenamide
MBS5806389 Inquire

Fosclevudine alafenamide

Sign In for Pricing
View Details
Eral1 Mouse shRNA Lentiviral Particle (Locus ID 57837)
TL503340V 500 µL Each

Eral1 Mouse shRNA Lentiviral Particle (Locus ID 57837)

Sign In for Pricing
View Details
Recombinant Human MAP4K5 protein, His-tagged
MAP4K5-3979H 25 µg

Recombinant Human MAP4K5 protein, His-tagged

Sign In for Pricing
View Details
HRP*Rabbit Anti Chicken IgY (IgG)
SA0104 100 µL

HRP*Rabbit Anti Chicken IgY (IgG)

Sign In for Pricing
View Details