Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRP-10, Human (HEK293, His)

The LRP-10 protein is a possible receptor that may mediate internalization and/or signaling of lipophilic molecules.It is speculated that LRP-10 can promote the uptake of lipoprotein APOE in the liver and may play a role in lipid metabolism and processes related to lipoprotein transport.LRP-10 Protein, Human (HEK293, His) is the recombinant human-derived LRP-10 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LRP-10 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lrp-10-protein-human-hek293-his.html

Purity

97.80

Smiles

HPDRIIFPNHACEDPPAVLLEVQGTLQRPLVRDSRTSPANCTWLILGSKEQTVTIRFQKLHLACGSERLTLRSPLQPLISLCEAPPSPLQLPGGNVTITYSYAGARAPMGQGFLLSYSQDWLMCLQEEFQCLNHRCVSAVQRCDGVDACGDGSDEAGCSSDPFPGLTPRPVPSLPCNVTLEDFYGVFSSPGYTHLASVSHPQSCHWLLDPHDGRRLAVRFTALDLGFGDAVHVYDGPGPPESSRLLRSLTHFSNGKAVTVETLSGQAVVSYHTVAWSNGRGFNATYHVRGYCLPWDRPCGLGSGLGAGEGLGERCYSEAQRCDGSWDCADGTDEEDCPGCPPGHFPCGAAGTSGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDGQPDCADGSDEWDCSYVLPRK

Molecular Formula

26020 (Gene_ID) Q7Z4F1-1 (H17-K440) (Accession)

Molecular Weight

Approximately 55 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Nurim Protein - (Dry Ice)
H00011270-P01-10ug 10 µg

Recombinant Human Nurim Protein - (Dry Ice)

Sign In for Pricing
View Details
pExpress-1-Cyp24a1 Plasmid
PVT39326 2 µg

pExpress-1-Cyp24a1 Plasmid

Sign In for Pricing
View Details
Rat Monoclonal CD9 Antibody (479608) [Biotin]
FAB5218B 0.1 mL

Rat Monoclonal CD9 Antibody (479608) [Biotin]

Sign In for Pricing
View Details
Human AKT2 (-/-) DLD-1 Cell Line
ABC-K00579 1 Vial

Human AKT2 (-/-) DLD-1 Cell Line

Sign In for Pricing
View Details
Lmna (NM_001002016) Rat Tagged ORF Clone Lentiviral Particle
RR204013L4V 200 µL

Lmna (NM_001002016) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mitochondrial fission Factor (MFF) Human ELISA Kit
F0234 96 Tests

Mitochondrial fission Factor (MFF) Human ELISA Kit

Sign In for Pricing
View Details