Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRP-10, Human (HEK293, His)

The LRP-10 protein is a possible receptor that may mediate internalization and/or signaling of lipophilic molecules.It is speculated that LRP-10 can promote the uptake of lipoprotein APOE in the liver and may play a role in lipid metabolism and processes related to lipoprotein transport.LRP-10 Protein, Human (HEK293, His) is the recombinant human-derived LRP-10 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LRP-10 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lrp-10-protein-human-hek293-his.html

Purity

97.80

Smiles

HPDRIIFPNHACEDPPAVLLEVQGTLQRPLVRDSRTSPANCTWLILGSKEQTVTIRFQKLHLACGSERLTLRSPLQPLISLCEAPPSPLQLPGGNVTITYSYAGARAPMGQGFLLSYSQDWLMCLQEEFQCLNHRCVSAVQRCDGVDACGDGSDEAGCSSDPFPGLTPRPVPSLPCNVTLEDFYGVFSSPGYTHLASVSHPQSCHWLLDPHDGRRLAVRFTALDLGFGDAVHVYDGPGPPESSRLLRSLTHFSNGKAVTVETLSGQAVVSYHTVAWSNGRGFNATYHVRGYCLPWDRPCGLGSGLGAGEGLGERCYSEAQRCDGSWDCADGTDEEDCPGCPPGHFPCGAAGTSGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDGQPDCADGSDEWDCSYVLPRK

Molecular Formula

26020 (Gene_ID) Q7Z4F1-1 (H17-K440) (Accession)

Molecular Weight

Approximately 55 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Klrb1c qPCR Primer Pair
QM16486S 200 Tests

Mouse Klrb1c qPCR Primer Pair

Sign In for Pricing
View Details
RecombinantFGF-acidic,Human
BK0051 10μg 

RecombinantFGF-acidic,Human

Sign In for Pricing
View Details
Mouse Pomk Pre-designed siRNA Set B
SI110913B 1 Each

Mouse Pomk Pre-designed siRNA Set B

Sign In for Pricing
View Details
Mafk (NM_010757) Mouse Tagged ORF Clone Lentiviral Particle
MR201177L4V 200 µL

Mafk (NM_010757) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Lyrm2 ORF Vector (Mouse) (pORF)
ORF049598 1.0 µg DNA

Lyrm2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Mouse Tumor Necrosis Factor Related Apoptosis Inducing Ligand ELISA Kit
MBS764619-01 48 Well

Mouse Tumor Necrosis Factor Related Apoptosis Inducing Ligand ELISA Kit

Sign In for Pricing
View Details