Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRP-10, Human (HEK293, His)

The LRP-10 protein is a possible receptor that may mediate internalization and/or signaling of lipophilic molecules.It is speculated that LRP-10 can promote the uptake of lipoprotein APOE in the liver and may play a role in lipid metabolism and processes related to lipoprotein transport.LRP-10 Protein, Human (HEK293, His) is the recombinant human-derived LRP-10 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LRP-10 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lrp-10-protein-human-hek293-his.html

Purity

97.80

Smiles

HPDRIIFPNHACEDPPAVLLEVQGTLQRPLVRDSRTSPANCTWLILGSKEQTVTIRFQKLHLACGSERLTLRSPLQPLISLCEAPPSPLQLPGGNVTITYSYAGARAPMGQGFLLSYSQDWLMCLQEEFQCLNHRCVSAVQRCDGVDACGDGSDEAGCSSDPFPGLTPRPVPSLPCNVTLEDFYGVFSSPGYTHLASVSHPQSCHWLLDPHDGRRLAVRFTALDLGFGDAVHVYDGPGPPESSRLLRSLTHFSNGKAVTVETLSGQAVVSYHTVAWSNGRGFNATYHVRGYCLPWDRPCGLGSGLGAGEGLGERCYSEAQRCDGSWDCADGTDEEDCPGCPPGHFPCGAAGTSGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDGQPDCADGSDEWDCSYVLPRK

Molecular Formula

26020 (Gene_ID) Q7Z4F1-1 (H17-K440) (Accession)

Molecular Weight

Approximately 55 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cpne8 3'UTR GFP Stable Cell Line
TU252740 1.0 mL

Cpne8 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Sheep Stabilin-2 (STAB2) ELISA Kit
MBS9395094-01 48 Well

Sheep Stabilin-2 (STAB2) ELISA Kit

Sign In for Pricing
View Details
Sheep Stabilin-2 (STAB2) ELISA Kit
MBS9395094-02 96 Well

Sheep Stabilin-2 (STAB2) ELISA Kit

Sign In for Pricing
View Details
Sheep Stabilin-2 (STAB2) ELISA Kit
MBS9395094-03 5x 96 Well

Sheep Stabilin-2 (STAB2) ELISA Kit

Sign In for Pricing
View Details
Sheep Stabilin-2 (STAB2) ELISA Kit
MBS9395094-04 10x 96 Well

Sheep Stabilin-2 (STAB2) ELISA Kit

Sign In for Pricing
View Details
OR6C7P Protein Vector (Human) (pPB-C-His)
PV108258 500 ng

OR6C7P Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details