Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRP-10, Human (HEK293, His)

The LRP-10 protein is a possible receptor that may mediate internalization and/or signaling of lipophilic molecules.It is speculated that LRP-10 can promote the uptake of lipoprotein APOE in the liver and may play a role in lipid metabolism and processes related to lipoprotein transport.LRP-10 Protein, Human (HEK293, His) is the recombinant human-derived LRP-10 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LRP-10 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lrp-10-protein-human-hek293-his.html

Purity

97.80

Smiles

HPDRIIFPNHACEDPPAVLLEVQGTLQRPLVRDSRTSPANCTWLILGSKEQTVTIRFQKLHLACGSERLTLRSPLQPLISLCEAPPSPLQLPGGNVTITYSYAGARAPMGQGFLLSYSQDWLMCLQEEFQCLNHRCVSAVQRCDGVDACGDGSDEAGCSSDPFPGLTPRPVPSLPCNVTLEDFYGVFSSPGYTHLASVSHPQSCHWLLDPHDGRRLAVRFTALDLGFGDAVHVYDGPGPPESSRLLRSLTHFSNGKAVTVETLSGQAVVSYHTVAWSNGRGFNATYHVRGYCLPWDRPCGLGSGLGAGEGLGERCYSEAQRCDGSWDCADGTDEEDCPGCPPGHFPCGAAGTSGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDGQPDCADGSDEWDCSYVLPRK

Molecular Formula

26020 (Gene_ID) Q7Z4F1-1 (H17-K440) (Accession)

Molecular Weight

Approximately 55 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCF4 (NM_001243235) Human Tagged ORF Clone
RG232887 10 µg

TCF4 (NM_001243235) Human Tagged ORF Clone

Sign In for Pricing
View Details
Horse Monoamine Oxidase A ELISA Kit
MBS014958-01 48 Well

Horse Monoamine Oxidase A ELISA Kit

Sign In for Pricing
View Details
Horse Monoamine Oxidase A ELISA Kit
MBS014958-02 96 Well

Horse Monoamine Oxidase A ELISA Kit

Sign In for Pricing
View Details
Horse Monoamine Oxidase A ELISA Kit
MBS014958-03 5x 96 Well

Horse Monoamine Oxidase A ELISA Kit

Sign In for Pricing
View Details
Horse Monoamine Oxidase A ELISA Kit
MBS014958-04 10x 96 Well

Horse Monoamine Oxidase A ELISA Kit

Sign In for Pricing
View Details
SIRP alpha/CD172a, His, Human
Z05839-500 500 µg

SIRP alpha/CD172a, His, Human

Sign In for Pricing
View Details