Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRP-10, Human (HEK293, His)

The LRP-10 protein is a possible receptor that may mediate internalization and/or signaling of lipophilic molecules.It is speculated that LRP-10 can promote the uptake of lipoprotein APOE in the liver and may play a role in lipid metabolism and processes related to lipoprotein transport.LRP-10 Protein, Human (HEK293, His) is the recombinant human-derived LRP-10 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LRP-10 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lrp-10-protein-human-hek293-his.html

Purity

97.80

Smiles

HPDRIIFPNHACEDPPAVLLEVQGTLQRPLVRDSRTSPANCTWLILGSKEQTVTIRFQKLHLACGSERLTLRSPLQPLISLCEAPPSPLQLPGGNVTITYSYAGARAPMGQGFLLSYSQDWLMCLQEEFQCLNHRCVSAVQRCDGVDACGDGSDEAGCSSDPFPGLTPRPVPSLPCNVTLEDFYGVFSSPGYTHLASVSHPQSCHWLLDPHDGRRLAVRFTALDLGFGDAVHVYDGPGPPESSRLLRSLTHFSNGKAVTVETLSGQAVVSYHTVAWSNGRGFNATYHVRGYCLPWDRPCGLGSGLGAGEGLGERCYSEAQRCDGSWDCADGTDEEDCPGCPPGHFPCGAAGTSGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDGQPDCADGSDEWDCSYVLPRK

Molecular Formula

26020 (Gene_ID) Q7Z4F1-1 (H17-K440) (Accession)

Molecular Weight

Approximately 55 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDUFA7 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C4]
TA502749BM 100 µL

NDUFA7 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C4]

Sign In for Pricing
View Details
LYRM2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV685534 1.0 µg DNA

LYRM2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
GENLISA™ Human Enteric CytopathicOrphan virus - Immunoglobulin G (ECHO - IgG) ELISA
KBH20761 96 Well

GENLISA™ Human Enteric CytopathicOrphan virus - Immunoglobulin G (ECHO - IgG) ELISA

Sign In for Pricing
View Details
CNTN5 Protein Vector (Rat) (pPB-C-His)
PV260942 500 ng

CNTN5 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
PLV3-U6-SMURF1 (human) -shRNA3-Puro
BZ47243 1 Vial

PLV3-U6-SMURF1 (human) -shRNA3-Puro

Sign In for Pricing
View Details
CD24L4 3'UTR Lenti-reporter-Luc Vector
54643081 1.0 µg

CD24L4 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details