Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRP-10, Human (HEK293, His)

The LRP-10 protein is a possible receptor that may mediate internalization and/or signaling of lipophilic molecules.It is speculated that LRP-10 can promote the uptake of lipoprotein APOE in the liver and may play a role in lipid metabolism and processes related to lipoprotein transport.LRP-10 Protein, Human (HEK293, His) is the recombinant human-derived LRP-10 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LRP-10 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lrp-10-protein-human-hek293-his.html

Purity

97.80

Smiles

HPDRIIFPNHACEDPPAVLLEVQGTLQRPLVRDSRTSPANCTWLILGSKEQTVTIRFQKLHLACGSERLTLRSPLQPLISLCEAPPSPLQLPGGNVTITYSYAGARAPMGQGFLLSYSQDWLMCLQEEFQCLNHRCVSAVQRCDGVDACGDGSDEAGCSSDPFPGLTPRPVPSLPCNVTLEDFYGVFSSPGYTHLASVSHPQSCHWLLDPHDGRRLAVRFTALDLGFGDAVHVYDGPGPPESSRLLRSLTHFSNGKAVTVETLSGQAVVSYHTVAWSNGRGFNATYHVRGYCLPWDRPCGLGSGLGAGEGLGERCYSEAQRCDGSWDCADGTDEEDCPGCPPGHFPCGAAGTSGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDGQPDCADGSDEWDCSYVLPRK

Molecular Formula

26020 (Gene_ID) Q7Z4F1-1 (H17-K440) (Accession)

Molecular Weight

Approximately 55 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FSD FluorTM 555 NHS ester
KOSC1003_25 mg 25 mg

FSD FluorTM 555 NHS ester

Sign In for Pricing
View Details
Stannsoporfin
202708 10.0mg

Stannsoporfin

Sign In for Pricing
View Details
PSMD6 Protein Vector (Rat) (pPM-C-HA)
PV296920 500 ng

PSMD6 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Genomic DNA, Human Adult Normal, Tissue, Brain, Cerebellum, Custom Donor, BioGenomicsTM
368515 100 µg

Genomic DNA, Human Adult Normal, Tissue, Brain, Cerebellum, Custom Donor, BioGenomicsTM

Sign In for Pricing
View Details
Mouse Interleukin 22 (IL22) Mini sample ELISA Kit
EKN52294 96 Tests

Mouse Interleukin 22 (IL22) Mini sample ELISA Kit

Sign In for Pricing
View Details
2,3,5,6-tetrachloroterephthalonitrile
RG-E140510-01 10 mg

2,3,5,6-tetrachloroterephthalonitrile

Sign In for Pricing
View Details