Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRP-10, Human (HEK293, His)

The LRP-10 protein is a possible receptor that may mediate internalization and/or signaling of lipophilic molecules.It is speculated that LRP-10 can promote the uptake of lipoprotein APOE in the liver and may play a role in lipid metabolism and processes related to lipoprotein transport.LRP-10 Protein, Human (HEK293, His) is the recombinant human-derived LRP-10 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LRP-10 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lrp-10-protein-human-hek293-his.html

Purity

97.80

Smiles

HPDRIIFPNHACEDPPAVLLEVQGTLQRPLVRDSRTSPANCTWLILGSKEQTVTIRFQKLHLACGSERLTLRSPLQPLISLCEAPPSPLQLPGGNVTITYSYAGARAPMGQGFLLSYSQDWLMCLQEEFQCLNHRCVSAVQRCDGVDACGDGSDEAGCSSDPFPGLTPRPVPSLPCNVTLEDFYGVFSSPGYTHLASVSHPQSCHWLLDPHDGRRLAVRFTALDLGFGDAVHVYDGPGPPESSRLLRSLTHFSNGKAVTVETLSGQAVVSYHTVAWSNGRGFNATYHVRGYCLPWDRPCGLGSGLGAGEGLGERCYSEAQRCDGSWDCADGTDEEDCPGCPPGHFPCGAAGTSGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDGQPDCADGSDEWDCSYVLPRK

Molecular Formula

26020 (Gene_ID) Q7Z4F1-1 (H17-K440) (Accession)

Molecular Weight

Approximately 55 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Transcription Factor Binding To Ighm Enhancer 3 (TFE3)
FY-AB46186-01 1 mL

Anti-Transcription Factor Binding To Ighm Enhancer 3 (TFE3)

Sign In for Pricing
View Details
Anti-Transcription Factor Binding To Ighm Enhancer 3 (TFE3)
FY-AB46186-02 100 µL

Anti-Transcription Factor Binding To Ighm Enhancer 3 (TFE3)

Sign In for Pricing
View Details
Anti-Transcription Factor Binding To Ighm Enhancer 3 (TFE3)
FY-AB46186-03 200 µL

Anti-Transcription Factor Binding To Ighm Enhancer 3 (TFE3)

Sign In for Pricing
View Details
Tmem123 Mouse qPCR Primer Pair (NM_133739)
MP217350 200 Reactions

Tmem123 Mouse qPCR Primer Pair (NM_133739)

Sign In for Pricing
View Details
Easypro Human Tumor Marker Ca724 (CA724) ELISA Kit
FY-EH1337S 96 Well

Easypro Human Tumor Marker Ca724 (CA724) ELISA Kit

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary
CS627034 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details