Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRP-10, Human (HEK293, His)

The LRP-10 protein is a possible receptor that may mediate internalization and/or signaling of lipophilic molecules.It is speculated that LRP-10 can promote the uptake of lipoprotein APOE in the liver and may play a role in lipid metabolism and processes related to lipoprotein transport.LRP-10 Protein, Human (HEK293, His) is the recombinant human-derived LRP-10 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LRP-10 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lrp-10-protein-human-hek293-his.html

Purity

97.80

Smiles

HPDRIIFPNHACEDPPAVLLEVQGTLQRPLVRDSRTSPANCTWLILGSKEQTVTIRFQKLHLACGSERLTLRSPLQPLISLCEAPPSPLQLPGGNVTITYSYAGARAPMGQGFLLSYSQDWLMCLQEEFQCLNHRCVSAVQRCDGVDACGDGSDEAGCSSDPFPGLTPRPVPSLPCNVTLEDFYGVFSSPGYTHLASVSHPQSCHWLLDPHDGRRLAVRFTALDLGFGDAVHVYDGPGPPESSRLLRSLTHFSNGKAVTVETLSGQAVVSYHTVAWSNGRGFNATYHVRGYCLPWDRPCGLGSGLGAGEGLGERCYSEAQRCDGSWDCADGTDEEDCPGCPPGHFPCGAAGTSGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDGQPDCADGSDEWDCSYVLPRK

Molecular Formula

26020 (Gene_ID) Q7Z4F1-1 (H17-K440) (Accession)

Molecular Weight

Approximately 55 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsp70 (AB1783) Rabbit mAb
M3133-01 20 µL

Hsp70 (AB1783) Rabbit mAb

Sign In for Pricing
View Details
Hsp70 (AB1783) Rabbit mAb
M3133-02 50 μL

Hsp70 (AB1783) Rabbit mAb

Sign In for Pricing
View Details
Hsp70 (AB1783) Rabbit mAb
M3133-03 100 µL

Hsp70 (AB1783) Rabbit mAb

Sign In for Pricing
View Details
Hsp70 (AB1783) Rabbit mAb
M3133-04 200 µL

Hsp70 (AB1783) Rabbit mAb

Sign In for Pricing
View Details
ZNF85 (Zinc Finger Protein 85, HPF4, HTF1, MGC78566) (MaxLight 490)
253883-ML490 100 µL

ZNF85 (Zinc Finger Protein 85, HPF4, HTF1, MGC78566) (MaxLight 490)

Sign In for Pricing
View Details
FBXW5, ID (FBXW5, FBW5, F-box/WD repeat-containing protein 5, F-box and WD-40 domain-containing protein 5) (PE)
MBS6298559-01 0.2 mL

FBXW5, ID (FBXW5, FBW5, F-box/WD repeat-containing protein 5, F-box and WD-40 domain-containing protein 5) (PE)

Sign In for Pricing
View Details