Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRP-10, Human (HEK293, His)

The LRP-10 protein is a possible receptor that may mediate internalization and/or signaling of lipophilic molecules.It is speculated that LRP-10 can promote the uptake of lipoprotein APOE in the liver and may play a role in lipid metabolism and processes related to lipoprotein transport.LRP-10 Protein, Human (HEK293, His) is the recombinant human-derived LRP-10 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LRP-10 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lrp-10-protein-human-hek293-his.html

Purity

97.80

Smiles

HPDRIIFPNHACEDPPAVLLEVQGTLQRPLVRDSRTSPANCTWLILGSKEQTVTIRFQKLHLACGSERLTLRSPLQPLISLCEAPPSPLQLPGGNVTITYSYAGARAPMGQGFLLSYSQDWLMCLQEEFQCLNHRCVSAVQRCDGVDACGDGSDEAGCSSDPFPGLTPRPVPSLPCNVTLEDFYGVFSSPGYTHLASVSHPQSCHWLLDPHDGRRLAVRFTALDLGFGDAVHVYDGPGPPESSRLLRSLTHFSNGKAVTVETLSGQAVVSYHTVAWSNGRGFNATYHVRGYCLPWDRPCGLGSGLGAGEGLGERCYSEAQRCDGSWDCADGTDEEDCPGCPPGHFPCGAAGTSGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDGQPDCADGSDEWDCSYVLPRK

Molecular Formula

26020 (Gene_ID) Q7Z4F1-1 (H17-K440) (Accession)

Molecular Weight

Approximately 55 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lrrfip2 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6601103 1.0 µg DNA

Lrrfip2 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Slit Homolog 3 (Slit3)
142328 200 µL

Slit Homolog 3 (Slit3)

Sign In for Pricing
View Details
Rad9b sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4840503 1.0 µg DNA

Rad9b sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
TIMP-2 shRNA Plasmid (m)
sc-37275-SH 20 µg

TIMP-2 shRNA Plasmid (m)

Sign In for Pricing
View Details
Chuk 3'UTR GFP Stable Cell Line
TU153900 1.0 mL

Chuk 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Kcp (NM_001029985) Mouse Tagged Lenti ORF Clone
MR217080L3 10 µg

Kcp (NM_001029985) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details