Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRP-10, Human (HEK293, His)

The LRP-10 protein is a possible receptor that may mediate internalization and/or signaling of lipophilic molecules.It is speculated that LRP-10 can promote the uptake of lipoprotein APOE in the liver and may play a role in lipid metabolism and processes related to lipoprotein transport.LRP-10 Protein, Human (HEK293, His) is the recombinant human-derived LRP-10 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LRP-10 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lrp-10-protein-human-hek293-his.html

Purity

97.80

Smiles

HPDRIIFPNHACEDPPAVLLEVQGTLQRPLVRDSRTSPANCTWLILGSKEQTVTIRFQKLHLACGSERLTLRSPLQPLISLCEAPPSPLQLPGGNVTITYSYAGARAPMGQGFLLSYSQDWLMCLQEEFQCLNHRCVSAVQRCDGVDACGDGSDEAGCSSDPFPGLTPRPVPSLPCNVTLEDFYGVFSSPGYTHLASVSHPQSCHWLLDPHDGRRLAVRFTALDLGFGDAVHVYDGPGPPESSRLLRSLTHFSNGKAVTVETLSGQAVVSYHTVAWSNGRGFNATYHVRGYCLPWDRPCGLGSGLGAGEGLGERCYSEAQRCDGSWDCADGTDEEDCPGCPPGHFPCGAAGTSGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDGQPDCADGSDEWDCSYVLPRK

Molecular Formula

26020 (Gene_ID) Q7Z4F1-1 (H17-K440) (Accession)

Molecular Weight

Approximately 55 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

A457
HY-129317 1 Each

A457

Sign In for Pricing
View Details
SHP2 Peptide
AF6412-BP 1 mg

SHP2 Peptide

Sign In for Pricing
View Details
Rabbit Monoclonal ADK Antibody (001) [CoraFluor 1]
NBP2-90184CL1 0.1 mL

Rabbit Monoclonal ADK Antibody (001) [CoraFluor 1]

Sign In for Pricing
View Details
TCEA1P4 sgRNA CRISPR Lentivector (Human) (Target 3)
K2346404 1.0 µg DNA

TCEA1P4 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Rhesus Monkey Eye Frozen Section
NHFF-1123-HX790 Each

Rhesus Monkey Eye Frozen Section

Sign In for Pricing
View Details
CCDC48 Protein Vector (Rat) (pPB-N-His)
PV257999 500 ng

CCDC48 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details