Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRP-10, Human (HEK293, His)

The LRP-10 protein is a possible receptor that may mediate internalization and/or signaling of lipophilic molecules.It is speculated that LRP-10 can promote the uptake of lipoprotein APOE in the liver and may play a role in lipid metabolism and processes related to lipoprotein transport.LRP-10 Protein, Human (HEK293, His) is the recombinant human-derived LRP-10 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LRP-10 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lrp-10-protein-human-hek293-his.html

Purity

97.80

Smiles

HPDRIIFPNHACEDPPAVLLEVQGTLQRPLVRDSRTSPANCTWLILGSKEQTVTIRFQKLHLACGSERLTLRSPLQPLISLCEAPPSPLQLPGGNVTITYSYAGARAPMGQGFLLSYSQDWLMCLQEEFQCLNHRCVSAVQRCDGVDACGDGSDEAGCSSDPFPGLTPRPVPSLPCNVTLEDFYGVFSSPGYTHLASVSHPQSCHWLLDPHDGRRLAVRFTALDLGFGDAVHVYDGPGPPESSRLLRSLTHFSNGKAVTVETLSGQAVVSYHTVAWSNGRGFNATYHVRGYCLPWDRPCGLGSGLGAGEGLGERCYSEAQRCDGSWDCADGTDEEDCPGCPPGHFPCGAAGTSGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDGQPDCADGSDEWDCSYVLPRK

Molecular Formula

26020 (Gene_ID) Q7Z4F1-1 (H17-K440) (Accession)

Molecular Weight

Approximately 55 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Usp28 sgRNA CRISPR Lentivector set (Rat)
K6661101 3x 1.0 µg

Usp28 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Rnf19b sgRNA CRISPR Lentivector (Rat) (Target 2)
K6434803 1.0 µg DNA

Rnf19b sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
pOTB7-NOP2 Plasmid
PVT18770 2 µg

pOTB7-NOP2 Plasmid

Sign In for Pricing
View Details
Neurochondrin (NCDN) Rabbit Polyclonal Antibody
AP55103SU-N 200 µL

Neurochondrin (NCDN) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal IQSEC1 Antibody [Alexa Fluor 750]
NBP2-81958AF750 0.1 mL

Rabbit Polyclonal IQSEC1 Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details
Anti-Hu CD95 APC
MBS1800915-01 100 Tests

Anti-Hu CD95 APC

Sign In for Pricing
View Details