Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRP-10, Human (HEK293, His)

The LRP-10 protein is a possible receptor that may mediate internalization and/or signaling of lipophilic molecules.It is speculated that LRP-10 can promote the uptake of lipoprotein APOE in the liver and may play a role in lipid metabolism and processes related to lipoprotein transport.LRP-10 Protein, Human (HEK293, His) is the recombinant human-derived LRP-10 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LRP-10 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lrp-10-protein-human-hek293-his.html

Purity

97.80

Smiles

HPDRIIFPNHACEDPPAVLLEVQGTLQRPLVRDSRTSPANCTWLILGSKEQTVTIRFQKLHLACGSERLTLRSPLQPLISLCEAPPSPLQLPGGNVTITYSYAGARAPMGQGFLLSYSQDWLMCLQEEFQCLNHRCVSAVQRCDGVDACGDGSDEAGCSSDPFPGLTPRPVPSLPCNVTLEDFYGVFSSPGYTHLASVSHPQSCHWLLDPHDGRRLAVRFTALDLGFGDAVHVYDGPGPPESSRLLRSLTHFSNGKAVTVETLSGQAVVSYHTVAWSNGRGFNATYHVRGYCLPWDRPCGLGSGLGAGEGLGERCYSEAQRCDGSWDCADGTDEEDCPGCPPGHFPCGAAGTSGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDGQPDCADGSDEWDCSYVLPRK

Molecular Formula

26020 (Gene_ID) Q7Z4F1-1 (H17-K440) (Accession)

Molecular Weight

Approximately 55 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal MAT1/2A Antibody [CoraFluor 1]
NB110-94162CL1 0.1 mL

Rabbit Polyclonal MAT1/2A Antibody [CoraFluor 1]

Sign In for Pricing
View Details
NIBAN2 (NM_022833) Human Tagged ORF Clone
RG220901 10 µg

NIBAN2 (NM_022833) Human Tagged ORF Clone

Sign In for Pricing
View Details
Phospho-PLB (Ser16) Recombinant Antibody, PerCP-Cy5.5 Conjugated
bsm-62841R-PerCP-Cy5.5 100 µL

Phospho-PLB (Ser16) Recombinant Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
BAF170 Polyclonal Antibody
UB-GEN-1520 100 µL

BAF170 Polyclonal Antibody

Sign In for Pricing
View Details
CCDC148 (NM_001171637) Human Tagged Lenti ORF Clone
RC229849L3 10 µg

CCDC148 (NM_001171637) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Kcng4 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3275902 1.0 µg DNA

Kcng4 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details