Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRP-10, Human (HEK293, His)

The LRP-10 protein is a possible receptor that may mediate internalization and/or signaling of lipophilic molecules.It is speculated that LRP-10 can promote the uptake of lipoprotein APOE in the liver and may play a role in lipid metabolism and processes related to lipoprotein transport.LRP-10 Protein, Human (HEK293, His) is the recombinant human-derived LRP-10 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LRP-10 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lrp-10-protein-human-hek293-his.html

Purity

97.80

Smiles

HPDRIIFPNHACEDPPAVLLEVQGTLQRPLVRDSRTSPANCTWLILGSKEQTVTIRFQKLHLACGSERLTLRSPLQPLISLCEAPPSPLQLPGGNVTITYSYAGARAPMGQGFLLSYSQDWLMCLQEEFQCLNHRCVSAVQRCDGVDACGDGSDEAGCSSDPFPGLTPRPVPSLPCNVTLEDFYGVFSSPGYTHLASVSHPQSCHWLLDPHDGRRLAVRFTALDLGFGDAVHVYDGPGPPESSRLLRSLTHFSNGKAVTVETLSGQAVVSYHTVAWSNGRGFNATYHVRGYCLPWDRPCGLGSGLGAGEGLGERCYSEAQRCDGSWDCADGTDEEDCPGCPPGHFPCGAAGTSGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDGQPDCADGSDEWDCSYVLPRK

Molecular Formula

26020 (Gene_ID) Q7Z4F1-1 (H17-K440) (Accession)

Molecular Weight

Approximately 55 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Volumetric Sol Ammonium Sulphate 0.5M (1.0N) - 5L
AS2055 5 L

Volumetric Sol Ammonium Sulphate 0.5M (1.0N) - 5L

Sign In for Pricing
View Details
Protein Tyrosine Phosphatase, Non Receptor Type 5 (PTPN5) Antibody
abx114874 100 µL

Protein Tyrosine Phosphatase, Non Receptor Type 5 (PTPN5) Antibody

Sign In for Pricing
View Details
TEX30 (NM_138779) Human Untagged Clone
SC327760 10 µg

TEX30 (NM_138779) Human Untagged Clone

Sign In for Pricing
View Details
3-[2-N- (Biotinyl) aminoethyldithio]propanoic Acid
B1759 100 mg

3-[2-N- (Biotinyl) aminoethyldithio]propanoic Acid

Sign In for Pricing
View Details
APEX2 Protein Vector (Human) (pPM-N-D-C-His)
PV322709 500 ng

APEX2 Protein Vector (Human) (pPM-N-D-C-His)

Sign In for Pricing
View Details
Map3k2, NT (Map3k2, Mekk2, Mitogen-activated protein kinase kinase kinase 2, MAPK/ERK kinase kinase 2) (APC) discontinued
038146-APC 200 µL

Map3k2, NT (Map3k2, Mekk2, Mitogen-activated protein kinase kinase kinase 2, MAPK/ERK kinase kinase 2) (APC) discontinued

Sign In for Pricing
View Details