Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRP-10, Human (HEK293, His)

The LRP-10 protein is a possible receptor that may mediate internalization and/or signaling of lipophilic molecules.It is speculated that LRP-10 can promote the uptake of lipoprotein APOE in the liver and may play a role in lipid metabolism and processes related to lipoprotein transport.LRP-10 Protein, Human (HEK293, His) is the recombinant human-derived LRP-10 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LRP-10 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lrp-10-protein-human-hek293-his.html

Purity

97.80

Smiles

HPDRIIFPNHACEDPPAVLLEVQGTLQRPLVRDSRTSPANCTWLILGSKEQTVTIRFQKLHLACGSERLTLRSPLQPLISLCEAPPSPLQLPGGNVTITYSYAGARAPMGQGFLLSYSQDWLMCLQEEFQCLNHRCVSAVQRCDGVDACGDGSDEAGCSSDPFPGLTPRPVPSLPCNVTLEDFYGVFSSPGYTHLASVSHPQSCHWLLDPHDGRRLAVRFTALDLGFGDAVHVYDGPGPPESSRLLRSLTHFSNGKAVTVETLSGQAVVSYHTVAWSNGRGFNATYHVRGYCLPWDRPCGLGSGLGAGEGLGERCYSEAQRCDGSWDCADGTDEEDCPGCPPGHFPCGAAGTSGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDGQPDCADGSDEWDCSYVLPRK

Molecular Formula

26020 (Gene_ID) Q7Z4F1-1 (H17-K440) (Accession)

Molecular Weight

Approximately 55 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal Angiopoietin-4 Antibody (RM0073-2H34) [DyLight 350]
NBP1-21700UV 0.1 mL

Rat Monoclonal Angiopoietin-4 Antibody (RM0073-2H34) [DyLight 350]

Sign In for Pricing
View Details
Glycoprotein Hormone Beta-5, Recombinant, Mouse, aa25-130, His-Tag
584713-01 20 µg

Glycoprotein Hormone Beta-5, Recombinant, Mouse, aa25-130, His-Tag

Sign In for Pricing
View Details
Glycoprotein Hormone Beta-5, Recombinant, Mouse, aa25-130, His-Tag
584713-02 100 µg

Glycoprotein Hormone Beta-5, Recombinant, Mouse, aa25-130, His-Tag

Sign In for Pricing
View Details
Transfer pipet, 1.2mL, 65mm
138040-S01 500/CS

Transfer pipet, 1.2mL, 65mm

Sign In for Pricing
View Details
PMCA1 Antibody, mAb, Rabbit
A04279-50 50 µL

PMCA1 Antibody, mAb, Rabbit

Sign In for Pricing
View Details
GATA3 (GATA Binding Protein 3, HDR, MGC2346, MGC5199, MGC5445) (MaxLight 750)
MBS6238390-01 0.1 mL

GATA3 (GATA Binding Protein 3, HDR, MGC2346, MGC5199, MGC5445) (MaxLight 750)

Sign In for Pricing
View Details