Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRP-10, Human (HEK293, His)

The LRP-10 protein is a possible receptor that may mediate internalization and/or signaling of lipophilic molecules.It is speculated that LRP-10 can promote the uptake of lipoprotein APOE in the liver and may play a role in lipid metabolism and processes related to lipoprotein transport.LRP-10 Protein, Human (HEK293, His) is the recombinant human-derived LRP-10 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LRP-10 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lrp-10-protein-human-hek293-his.html

Purity

97.80

Smiles

HPDRIIFPNHACEDPPAVLLEVQGTLQRPLVRDSRTSPANCTWLILGSKEQTVTIRFQKLHLACGSERLTLRSPLQPLISLCEAPPSPLQLPGGNVTITYSYAGARAPMGQGFLLSYSQDWLMCLQEEFQCLNHRCVSAVQRCDGVDACGDGSDEAGCSSDPFPGLTPRPVPSLPCNVTLEDFYGVFSSPGYTHLASVSHPQSCHWLLDPHDGRRLAVRFTALDLGFGDAVHVYDGPGPPESSRLLRSLTHFSNGKAVTVETLSGQAVVSYHTVAWSNGRGFNATYHVRGYCLPWDRPCGLGSGLGAGEGLGERCYSEAQRCDGSWDCADGTDEEDCPGCPPGHFPCGAAGTSGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDGQPDCADGSDEWDCSYVLPRK

Molecular Formula

26020 (Gene_ID) Q7Z4F1-1 (H17-K440) (Accession)

Molecular Weight

Approximately 55 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLXDC2 (Plexin Domain-containing Protein 2, Tumor Endothelial Marker 7-related Protein, TEM7R, UNQ2514/PRO6003, FLJ14623) (MaxLight 750)
MBS6234581-01 0.1 mL

PLXDC2 (Plexin Domain-containing Protein 2, Tumor Endothelial Marker 7-related Protein, TEM7R, UNQ2514/PRO6003, FLJ14623) (MaxLight 750)

Sign In for Pricing
View Details
PLXDC2 (Plexin Domain-containing Protein 2, Tumor Endothelial Marker 7-related Protein, TEM7R, UNQ2514/PRO6003, FLJ14623) (MaxLight 750)
MBS6234581-02 5x 0.1 mL

PLXDC2 (Plexin Domain-containing Protein 2, Tumor Endothelial Marker 7-related Protein, TEM7R, UNQ2514/PRO6003, FLJ14623) (MaxLight 750)

Sign In for Pricing
View Details
Recombinant Human Glycodelin Protein, His, Mammal-100ug
QP6462-ma-100ug 100ug

Recombinant Human Glycodelin Protein, His, Mammal-100ug

Sign In for Pricing
View Details
Recombinant Chicken Collagen alpha-3 (IX) chain (COL9A3), partial
MBS718346 Inquire

Recombinant Chicken Collagen alpha-3 (IX) chain (COL9A3), partial

Sign In for Pricing
View Details
GLYR1 Rabbit Polyclonal Antibody
TA376616 100 µL

GLYR1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
5-deoxypulchelloside I
TBW01677 unit

5-deoxypulchelloside I

Sign In for Pricing
View Details