Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRP-10, Human (HEK293, His)

The LRP-10 protein is a possible receptor that may mediate internalization and/or signaling of lipophilic molecules.It is speculated that LRP-10 can promote the uptake of lipoprotein APOE in the liver and may play a role in lipid metabolism and processes related to lipoprotein transport.LRP-10 Protein, Human (HEK293, His) is the recombinant human-derived LRP-10 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LRP-10 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lrp-10-protein-human-hek293-his.html

Purity

97.80

Smiles

HPDRIIFPNHACEDPPAVLLEVQGTLQRPLVRDSRTSPANCTWLILGSKEQTVTIRFQKLHLACGSERLTLRSPLQPLISLCEAPPSPLQLPGGNVTITYSYAGARAPMGQGFLLSYSQDWLMCLQEEFQCLNHRCVSAVQRCDGVDACGDGSDEAGCSSDPFPGLTPRPVPSLPCNVTLEDFYGVFSSPGYTHLASVSHPQSCHWLLDPHDGRRLAVRFTALDLGFGDAVHVYDGPGPPESSRLLRSLTHFSNGKAVTVETLSGQAVVSYHTVAWSNGRGFNATYHVRGYCLPWDRPCGLGSGLGAGEGLGERCYSEAQRCDGSWDCADGTDEEDCPGCPPGHFPCGAAGTSGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDGQPDCADGSDEWDCSYVLPRK

Molecular Formula

26020 (Gene_ID) Q7Z4F1-1 (H17-K440) (Accession)

Molecular Weight

Approximately 55 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cy3-Linked Monoclonal Antibody to Phosphoglycerate Mutase 1, Brain (PGAM1)
MBS2146082-01 0.1 mL

Cy3-Linked Monoclonal Antibody to Phosphoglycerate Mutase 1, Brain (PGAM1)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Phosphoglycerate Mutase 1, Brain (PGAM1)
MBS2146082-02 0.2 mL

Cy3-Linked Monoclonal Antibody to Phosphoglycerate Mutase 1, Brain (PGAM1)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Phosphoglycerate Mutase 1, Brain (PGAM1)
MBS2146082-03 0.5 mL

Cy3-Linked Monoclonal Antibody to Phosphoglycerate Mutase 1, Brain (PGAM1)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Phosphoglycerate Mutase 1, Brain (PGAM1)
MBS2146082-04 1 mL

Cy3-Linked Monoclonal Antibody to Phosphoglycerate Mutase 1, Brain (PGAM1)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Phosphoglycerate Mutase 1, Brain (PGAM1)
MBS2146082-05 5 mL

Cy3-Linked Monoclonal Antibody to Phosphoglycerate Mutase 1, Brain (PGAM1)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Phosphoglycerate Mutase 1, Brain (PGAM1)
MBS2146082-06 5x 5 mL

Cy3-Linked Monoclonal Antibody to Phosphoglycerate Mutase 1, Brain (PGAM1)

Sign In for Pricing
View Details