Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nucleoprotein/NP, HCoV-NL63 (sf9, His, myc)

Nucleoprotein/NP proteins play a crucial role in assembling viral particles and facilitating the packaging of positive-strand viral genomic RNA into helical ribonucleocapsids (RNPs) . Its interaction with the viral genome and membrane protein M is critical for virion assembly. Nucleoprotein/NP Protein, HCoV-NL63 (sf9, His, myc) is the recombinant Virus-derived Nucleoprotein/NP protein, expressed by sf9 insect cells , with C-Myc, N-10*His labeled tag.

Product Specifications

Product Name Alternative

Nucleoprotein/NP Protein, HCoV-NL63 (sf9, His, myc), Virus, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nucleoprotein-human-sf9-his-myc.html

Purity

90.00

Smiles

MASVNWADDRAARKKFPPPSFYMPLLVSSDKAPYRVIPRNLVPIGKGNKDEQIGYWNVQERWRMRRGQRVDLPPKVHFYYLGTGPHKDLKFRQRSDGVVWVAKEGAKTVNTSLGNRKRNQKPLEPKFSIALPPELSVVEFEDRSNNSSRASSRSSTRNNSRDSSRSTSRQQSRTRSDSNQSSSDLVAAVTLALKNLGFDNQSKSPSSSGTSTPKKPNKPLSQPRADKPSQLKKPRWKRVPTREENVIQCFGPRDFNHNMGDSDLVQNGVDAKGFPQLAELIPNQAALFFDSEVSTDEVGDNVQITYTYKMLVAKDNKNLPKFIEQISAFTKPSSIKEMQSQSSHVAQNTVLNASIPESKPLADDDSAIIEIVNEVLH

Molecular Formula

2943504 (Gene_ID) Q6Q1R8 (M1-H377) (Accession)

Molecular Weight

Approximately 46.3kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMA1 Recombinant Antibody, Cy5 Conjugated
bsm-60572R-Cy5 100 µL

PSMA1 Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Dibromopropamidine-d6 Dihydrochloride
TRC-D425802-10MG 10 mg

Dibromopropamidine-d6 Dihydrochloride

Sign In for Pricing
View Details
Smad2/3, phosphorylated (T8) discontinued
506049-01 50 µL

Smad2/3, phosphorylated (T8) discontinued

Sign In for Pricing
View Details
Smad2/3, phosphorylated (T8) discontinued
506049-02 100 µL

Smad2/3, phosphorylated (T8) discontinued

Sign In for Pricing
View Details
Hamster Capping Protein Muscle Z Line Beta ELISA Kit
MBS083214-01 48 Well

Hamster Capping Protein Muscle Z Line Beta ELISA Kit

Sign In for Pricing
View Details
Hamster Capping Protein Muscle Z Line Beta ELISA Kit
MBS083214-02 96 Well

Hamster Capping Protein Muscle Z Line Beta ELISA Kit

Sign In for Pricing
View Details