Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD81 antigen (CD81), partial (Active)

Product Specifications

Product Name Alternative

TAPA1; TSPAN28

Abbreviation

Recombinant Human CD81 protein, partial (Active)

Gene Name

CD81

UniProt

P60033

Expression Region

113-201aa

Organism

Homo sapiens (Human)

Target Sequence

FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK

Tag

C-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Structural component of specialized membrane microdomains known as tetraspanin-enriched microdomains (TERMs), which act as platforms for receptor clustering and signaling. Essential for trafficking and compartmentalization of CD19 receptor on the surface of activated B cells.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human CD81 at 2 μg/mL can bind Anti-CD81 recombinant antibody (CSB-RA004960MA1HU), the EC50 is 4.166-5.578 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

11.1 kDa

References & Citations

"TAPA-1, the target of an antiproliferative antibody, defines a new family of transmembrane proteins." Oren R., Takahashi S., Doss C., Levy R., Levy S. Mol. Cell. Biol. 10:4007-4015 (1990)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse TNFRSF17/Tumor Necrosis Factor Receptor Superfamily Member 17 ELISA Kit
MBS2891096-01 48 Well

Mouse TNFRSF17/Tumor Necrosis Factor Receptor Superfamily Member 17 ELISA Kit

Sign In for Pricing
View Details
Mouse TNFRSF17/Tumor Necrosis Factor Receptor Superfamily Member 17 ELISA Kit
MBS2891096-02 96 Well

Mouse TNFRSF17/Tumor Necrosis Factor Receptor Superfamily Member 17 ELISA Kit

Sign In for Pricing
View Details
Mouse TNFRSF17/Tumor Necrosis Factor Receptor Superfamily Member 17 ELISA Kit
MBS2891096-03 5x 96 Well

Mouse TNFRSF17/Tumor Necrosis Factor Receptor Superfamily Member 17 ELISA Kit

Sign In for Pricing
View Details
Mouse TNFRSF17/Tumor Necrosis Factor Receptor Superfamily Member 17 ELISA Kit
MBS2891096-04 10x 96 Well

Mouse TNFRSF17/Tumor Necrosis Factor Receptor Superfamily Member 17 ELISA Kit

Sign In for Pricing
View Details
SRRM4 siRNA (Human)
CRJ3513-01 15 nmol

SRRM4 siRNA (Human)

Sign In for Pricing
View Details
SRRM4 siRNA (Human)
CRJ3513-02 30 nmol

SRRM4 siRNA (Human)

Sign In for Pricing
View Details