Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRABP1, Human

The CRABP1 protein is present in the cytoplasm and is involved in regulating the entry of retinoic acid into nuclear retinoic acid receptors. As an important molecular player, CRABP1 may mediate the complex process of interaction between retinoic acid and its nuclear receptor. CRABP1 Protein, Human is the recombinant human-derived CRABP1 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

CRABP1 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/crabp1-protein-human.html

Purity

98.0

Smiles

MPNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVRTTEINFKVGEGFEEETVDGRKCRSLATWENENKIHCTQTLLEGDGPKTYWTRELANDELILTFGADDVVCTRIYVRE

Molecular Formula

1381 (Gene_ID) AAH22069.1 (M1-E137) (Accession)

Molecular Weight

Approximately 14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Posaconazole Impurity P
RM-P190316-01 10 mg

Posaconazole Impurity P

Sign In for Pricing
View Details
Posaconazole Impurity P
RM-P190316-02 25 mg

Posaconazole Impurity P

Sign In for Pricing
View Details
Posaconazole Impurity P
RM-P190316-03 50 mg

Posaconazole Impurity P

Sign In for Pricing
View Details
Posaconazole Impurity P
RM-P190316-04 100 mg

Posaconazole Impurity P

Sign In for Pricing
View Details
KRT82 (NM_033033) Human Over-expression Lysate
LS003888-100ug 100 µg

KRT82 (NM_033033) Human Over-expression Lysate

Sign In for Pricing
View Details
ELISA Kit For WNT1-inducible-signaling pathway protein 1
E1116h 96 Tests

ELISA Kit For WNT1-inducible-signaling pathway protein 1

Sign In for Pricing
View Details