Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRABP1, Human

The CRABP1 protein is present in the cytoplasm and is involved in regulating the entry of retinoic acid into nuclear retinoic acid receptors. As an important molecular player, CRABP1 may mediate the complex process of interaction between retinoic acid and its nuclear receptor. CRABP1 Protein, Human is the recombinant human-derived CRABP1 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

CRABP1 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/crabp1-protein-human.html

Purity

98.0

Smiles

MPNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVRTTEINFKVGEGFEEETVDGRKCRSLATWENENKIHCTQTLLEGDGPKTYWTRELANDELILTFGADDVVCTRIYVRE

Molecular Formula

1381 (Gene_ID) AAH22069.1 (M1-E137) (Accession)

Molecular Weight

Approximately 14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse RAD52 motif-containing protein 1 (RDM1) ELISA Kit
abx541786 96 Tests

Mouse RAD52 motif-containing protein 1 (RDM1) ELISA Kit

Sign In for Pricing
View Details
SYNE4 Rabbit Polyclonal Antibody (FITC)
orb2118606 100 µL

SYNE4 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Slc7a3 siRNA Oligos set (Rat)
44279176 3x 5 nmol

Slc7a3 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
SLX4/BTBD12 Polyclonal Antibody
MBS9237406-01 0.1 mL

SLX4/BTBD12 Polyclonal Antibody

Sign In for Pricing
View Details
SLX4/BTBD12 Polyclonal Antibody
MBS9237406-02 5x 0.1 mL

SLX4/BTBD12 Polyclonal Antibody

Sign In for Pricing
View Details
Olfr53 (NM_146960) Mouse Untagged Clone
MC214088 10 µg

Olfr53 (NM_146960) Mouse Untagged Clone

Sign In for Pricing
View Details