Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSLP, Human (HEK293, His)

TSLP Protein, a cytokine, stimulates T-cell-attracting chemokine release from monocytes and enhances CD11c (+) dendritic cell maturation. It directly activates mast cells, possibly inducing allergic inflammation. TSLP may also possess antimicrobial properties in the oral cavity and on the skin. TSLP Protein, Human (HEK293, His) is the recombinant human-derived TSLP protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

TSLP Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tslp-protein-human-hek-293-his.html

Purity

98.0

Smiles

YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ

Molecular Formula

85480 (Gene_ID) Q969D9-1 (Y29-Q159) (Accession)

Molecular Weight

Approximately 8-10 kDa & 16-27 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anks6 sgRNA CRISPR Lentivector (Rat) (Target 3)
K7278604 1.0 µg DNA

Anks6 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
MMP-13 discontinued
539057-01 30ul

MMP-13 discontinued

Sign In for Pricing
View Details
MMP-13 discontinued
539057-02 100 µL

MMP-13 discontinued

Sign In for Pricing
View Details
IFNA6 Adenovirus (Mouse)
24259054 1.0 mL

IFNA6 Adenovirus (Mouse)

Sign In for Pricing
View Details
CCDC135 Rabbit pAb
E47R8082 100 µL

CCDC135 Rabbit pAb

Sign In for Pricing
View Details
LT-β Lentiviral Activation Particles (m2)
sc-421479-LAC-2 200 µL

LT-β Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details