Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig E-selectin (SELE), partial

Product Specifications

Product Name Alternative

CD62 antigen-like family member EEndothelial leukocyte adhesion molecule 1 ; ELAM-1Leukocyte-endothelial cell adhesion molecule 2 ; LECAM2; ; CD62E

Abbreviation

Recombinant Pig SELE protein, partial

Gene Name

SELE

UniProt

P98110

Expression Region

23-429aa

Organism

Sus scrofa (Pig)

Target Sequence

WSYSASTETMTFDDASAYCQQRYTHLVAIQNHAEIEYLNSTFNYSASYYWIGIRKINGTWTWIGTKKALTPEATNWAPGEPNNKQSNEDCVEIYIKRDKDSGKWNDERCSKKKLALCYTAACTPTSCSGHGECIETINSSTCQCYPGFRGLQCEQVVECDALENPVNGVVTCPQSLPWNTTCAFECKEGFELIGPEHLQCTSSGSWDGKKPTCKAVTCDTVGHPQNGDVSCNHSSIGEFAYKSTCHFTCAEGFGLQGPAQIECTAQGQWTQQAPVCKAVKCPAVSQPKNGLVKFTHSPTGEFTYKSSCAFSCEEGFELRGSAQLACTSQGQWTQEVPSCQVVQCSSLEVPREINMSCSGEPVFGAVCTFACPEGWMLNGSVALTCGATGHWSGMLPTCEAPAESKIP

Tag

Tag-Free

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Cell-surface glycoprotein having a role in immunoadhesion. Mediates in the adhesion of blood neutrophils in cytokine-activated endothelium through interaction with PSGL1/SELPLG. May have a role in capillary morphogenesis.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

44.4 kDa

References & Citations

Molecular and functional analysis of porcine E-selectin reveals a potential role in xenograft rejection.Rollins S.A., Evans M.J., Johnson K.K., Elliot E.A., Squinto S.P., Matis L.A., Rother R.P.Biochem. Biophys. Res. Commun. 204:763-771 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine P27 Protein ELISA Kit
MBS750799-01 48 Well

Bovine P27 Protein ELISA Kit

Sign In for Pricing
View Details
Bovine P27 Protein ELISA Kit
MBS750799-02 96 Well

Bovine P27 Protein ELISA Kit

Sign In for Pricing
View Details
Bovine P27 Protein ELISA Kit
MBS750799-03 5x 96 Well

Bovine P27 Protein ELISA Kit

Sign In for Pricing
View Details
Bovine P27 Protein ELISA Kit
MBS750799-04 10x 96 Well

Bovine P27 Protein ELISA Kit

Sign In for Pricing
View Details
Rat Inhibin Beta E (INHbE) ELISA Kit
MBS2707433-01 24 Strip Well

Rat Inhibin Beta E (INHbE) ELISA Kit

Sign In for Pricing
View Details
Rat Inhibin Beta E (INHbE) ELISA Kit
MBS2707433-02 48 Well

Rat Inhibin Beta E (INHbE) ELISA Kit

Sign In for Pricing
View Details