Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD200R1L, Human (HEK293, His)

The CD200R1L protein is a potential receptor for the CD200/OX2 cell surface glycoprotein and has been shown to play a role in mediating cellular responses associated with CD200 signaling. As a receptor, CD200R1L may engage in complex interactions with CD200, contributing to immune regulation and cellular communication. CD200R1L Protein, Human (HEK293, His) is the recombinant human-derived CD200R1L protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD200R1L Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd200r1l-protein-human-hek293-his.html

Purity

95.0

Smiles

GKQMTQNYSTIFAEGNISQPVLMDINAVLCCPPIALRNLIIITWEIILRGQPSCTKAYKKETNETKETNCTVERITWVSRPDQNSDLQIRPVDTTHDGYYRGIVVTPDGNFHRGYHLQVLVTPEVNLFQSRNITAVCKAVTGKPAAQISWIPEGSILATKQEYWGNGTVTVKSTCPWEGHKSTVTCHVSHLTGNKSLSVKLNSGLRTSGSPALSLL

Molecular Formula

344807 (Gene_ID) Q6Q8B3-1 (G24-L239) (Accession)

Molecular Weight

Approximately 40-56 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zonampanel 1mg
A21199-1 1 mg

Zonampanel 1mg

Sign In for Pricing
View Details
Yes (D9P3E) Rabbit Monoclonal Antibody
CST 65890S 100 µL

Yes (D9P3E) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
ITGB7 Monoclonal Antibody
BT-MCA3092-01 50 µL

ITGB7 Monoclonal Antibody

Sign In for Pricing
View Details
ITGB7 Monoclonal Antibody
BT-MCA3092-02 100 µL

ITGB7 Monoclonal Antibody

Sign In for Pricing
View Details
Sartorius Filter Paper G292 42mm
SAR2026 100 / PCK

Sartorius Filter Paper G292 42mm

Sign In for Pricing
View Details
NUDC 3'UTR GFP Stable Cell Line
TU066055 1.0 mL

NUDC 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details