Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schmidtea mediterranea Activin 2, partial

Product Specifications

Product Name Alternative

Activin 2 (Fragment)

Abbreviation

Recombinant Schmidtea mediterranea Activin 2 protein, partial

UniProt

U3RAB9

Expression Region

64-406aa

Organism

Schmidtea mediterranea (Freshwater planarian flatworm)

Target Sequence

NPVERKSSVYNDNAEEKIIQKDSFKDKVINDLKSKILQKLNLKEAPKFNSSFDWSSMTEQIRSAALRLGVPFDETTENSQPTSESMIISLTKVNHCIDNSTNNQHCYDLTIPNMDNKILVGANFIIQFLPLAFERTVEDNIIYNITINNLPETVYSFSVAQLKSNSLYIAYTNILKTLLDNQRMSHSTFSFTVSISGDEQTTKLERMIDIENIVIELEYQVLPTPVRKRRDAGNTCIPNTYFCCTQTLKVGIDELGWSQFIFAPTTFTINYCRGDCNSYLTFSSNHARALNFARGRGLGSNKDLRACCVPYSYSSLTIMYLNNENALEVSTFNDLIAATCGCM

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

42.9 kDa

References & Citations

"Tissue absence initiates regeneration through Follistatin-mediated inhibition of Activin signaling." Gavino M.A., Wenemoser D., Wang I.E., Reddien P.W. Elife 2:E00247-E00247 (2013)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MGAT4B Recombinant Protein Antigen
NBP3-17394PEP 100 µL

MGAT4B Recombinant Protein Antigen

Sign In for Pricing
View Details
Hamster Alpha-Actin (AACT) ELISA Kit
MBS9395746-01 48 Well

Hamster Alpha-Actin (AACT) ELISA Kit

Sign In for Pricing
View Details
Hamster Alpha-Actin (AACT) ELISA Kit
MBS9395746-02 96 Well

Hamster Alpha-Actin (AACT) ELISA Kit

Sign In for Pricing
View Details
Hamster Alpha-Actin (AACT) ELISA Kit
MBS9395746-03 5x 96 Well

Hamster Alpha-Actin (AACT) ELISA Kit

Sign In for Pricing
View Details
Hamster Alpha-Actin (AACT) ELISA Kit
MBS9395746-04 10x 96 Well

Hamster Alpha-Actin (AACT) ELISA Kit

Sign In for Pricing
View Details
TRNAW9 CRISPRa sgRNA lentivector (set of three targets)(Human)
48473121 3x 1.0µg DNA

TRNAW9 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details