Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schmidtea mediterranea Activin 2, partial

Product Specifications

Product Name Alternative

Activin 2 (Fragment)

Abbreviation

Recombinant Schmidtea mediterranea Activin 2 protein, partial

UniProt

U3RAB9

Expression Region

64-406aa

Organism

Schmidtea mediterranea (Freshwater planarian flatworm)

Target Sequence

NPVERKSSVYNDNAEEKIIQKDSFKDKVINDLKSKILQKLNLKEAPKFNSSFDWSSMTEQIRSAALRLGVPFDETTENSQPTSESMIISLTKVNHCIDNSTNNQHCYDLTIPNMDNKILVGANFIIQFLPLAFERTVEDNIIYNITINNLPETVYSFSVAQLKSNSLYIAYTNILKTLLDNQRMSHSTFSFTVSISGDEQTTKLERMIDIENIVIELEYQVLPTPVRKRRDAGNTCIPNTYFCCTQTLKVGIDELGWSQFIFAPTTFTINYCRGDCNSYLTFSSNHARALNFARGRGLGSNKDLRACCVPYSYSSLTIMYLNNENALEVSTFNDLIAATCGCM

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

42.9 kDa

References & Citations

"Tissue absence initiates regeneration through Follistatin-mediated inhibition of Activin signaling." Gavino M.A., Wenemoser D., Wang I.E., Reddien P.W. Elife 2:E00247-E00247 (2013)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD27 Antigen / TNFRSF7 (CD27) Antibody (AF647)
abx229232-01 20 Tests

CD27 Antigen / TNFRSF7 (CD27) Antibody (AF647)

Sign In for Pricing
View Details
CD27 Antigen / TNFRSF7 (CD27) Antibody (AF647)
abx229232-02 100 Tests

CD27 Antigen / TNFRSF7 (CD27) Antibody (AF647)

Sign In for Pricing
View Details
CD27 Antigen / TNFRSF7 (CD27) Antibody (AF647)
abx229232-03 200 Tests

CD27 Antigen / TNFRSF7 (CD27) Antibody (AF647)

Sign In for Pricing
View Details
LightSpeed BamHI
HTNP1020 500 Tests

LightSpeed BamHI

Sign In for Pricing
View Details
Rabbit Polyclonal GPI7 Antibody [PerCP]
NBP2-98099PCP 0.1 mL

Rabbit Polyclonal GPI7 Antibody [PerCP]

Sign In for Pricing
View Details
Anti Rhodopirellula Sallentina ATPase Pab
272181 100 µg

Anti Rhodopirellula Sallentina ATPase Pab

Sign In for Pricing
View Details