Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Matrix metalloproteinase-20 (MMP20)

Product Specifications

CAS Number

9000-83-3

Gene Name

MMP20

UniProt

O60882

Expression Region

108-483aa

Organism

Homo sapiens

Target Sequence

YRLFPGEPKWKKNTLTYRISKYTPSMSSVEVDKAVEMALQAWSSAVPLSFVRINSGEADIMISFENGDHGDSYPFDGPRGTLAHAFAPGEGLGGDTHFDNAEKWTMGTNGFNLFTVAAHEFGHALGLAHSTDPSALMYPTYKYKNPYGFHLPKDDVKGIQALYGPRKVFLGKPTLPHAPHHKPSIPDLCDSSSSFDAVTMLGKELLLFKDRIFWRRQVHLRTGIRPSTITSSFPQLMSNVDAAYEVAERGTAYFFKGPHYWITRGFQMQGPPRTIYDFGFPRHVQQIDAAVYLREPQKTLFFVGDEYYSYDERKRKMEKDYPKNTEEEFSGVNGQIDAAVELNGYIYFFSGPKTYKYDTEKEDVVSVVKSSSWIGC

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Mammalian cell

Field of Research

Others

Assay Type

Developed Protein

Relevance

Degrades amelogenin, the major protein component of the enamel matrix and two of the macromolecules characterizing the cartilage extracellular matrix: aggrecan and the cartilage oligomeric matrix protein. May play a central role in tooth enamel formation. Cleaves aggrecan at the '360-Asn-|-Phe-361' site.

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Length

Full Length of Mature Protein

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

47.6 kDa

References & Citations

"Catalytic domain of MMP20 (Enamelysin) - the NMR structure of a new matrix metalloproteinase." Arendt Y., Banci L., Bertini I., Cantini F., Cozzi R., Del Conte R., Gonnelli L. FEBS Lett. 581:4723-4726 (2007)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nat8 (NM_022635) Rat Tagged ORF Clone Lentiviral Particle
RR211499L4V 200 µL

Nat8 (NM_022635) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
BFAR (N-Term) Rabbit pAb
MBS8552724-01 0.1 mL

BFAR (N-Term) Rabbit pAb

Sign In for Pricing
View Details
BFAR (N-Term) Rabbit pAb
MBS8552724-02 0.1 mL (AF405L)

BFAR (N-Term) Rabbit pAb

Sign In for Pricing
View Details
BFAR (N-Term) Rabbit pAb
MBS8552724-03 0.1 mL (AF405S)

BFAR (N-Term) Rabbit pAb

Sign In for Pricing
View Details
BFAR (N-Term) Rabbit pAb
MBS8552724-04 0.1 mL (AF610)

BFAR (N-Term) Rabbit pAb

Sign In for Pricing
View Details
BFAR (N-Term) Rabbit pAb
MBS8552724-05 0.1 mL (AF635)

BFAR (N-Term) Rabbit pAb

Sign In for Pricing
View Details