Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine IFN alpha protein

The Bovine IFN alpha A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IFN alpha A applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine IFN alpha A yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IFN alpha A Specifications: (Molecular Weight: 19.0 kDa) (Amino Acid Sequence: CHLPHTHSLA NRRVLMLLQQ LRRVSPSSCL QDRNDFEFLQ EALGGSQLQK AQAISVLHEV TQHTFQLFST EGSPATWDKS LLDKLRAALD QQLTDLQACL TQEEGLRGAP LLKEDSSLAV RKYFHRLTLY LQEKRHSPCA WEVVRAEVMR AFSSSTNLQE SFRRKD (166) ) (Gene ID: 515951) .

Product Specifications

Source

Yeast

Origin

Bovine

Field of Research

Infectious Disease & Virology

Purity

98%

Form

Lyophilized

Molecular Weight

19.0 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

CHLPHTHSLANRRVLMLLQQLRRVSPSSCLQDRNDFEFLQEALGGSQLQKAQAISVLHEVTQHTFQLFSTEGSPATWDKSLLDKLRAALDQQLTDLQACLTQEEGLRGAPLLKEDSSLAVRKYFHRLTLYLQEKRHSPCAWEVVRAEVMRAFSSSTNLQESFRRKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SYDE1 (NM_033025) Human Over-expression Lysate
LS085360-100ug 100 µg

SYDE1 (NM_033025) Human Over-expression Lysate

Sign In for Pricing
View Details
HDAC7A (Histone Deacetylase 7, HD7, Histone Deacetylase 7A, HD7a, HDAC7A, DKFZp586J0917, DKFZP586J0917, FLJ99588) (PE)
127770-PE 100 µL

HDAC7A (Histone Deacetylase 7, HD7, Histone Deacetylase 7A, HD7a, HDAC7A, DKFZp586J0917, DKFZP586J0917, FLJ99588) (PE)

Sign In for Pricing
View Details
Nucleoside Diphosphate Kinase B (NME2) Antibody
abx006956-01 20 µL

Nucleoside Diphosphate Kinase B (NME2) Antibody

Sign In for Pricing
View Details
Nucleoside Diphosphate Kinase B (NME2) Antibody
abx006956-02 100 µL

Nucleoside Diphosphate Kinase B (NME2) Antibody

Sign In for Pricing
View Details
Nucleoside Diphosphate Kinase B (NME2) Antibody
abx006956-03 2x 100 µL

Nucleoside Diphosphate Kinase B (NME2) Antibody

Sign In for Pricing
View Details
Recombinant Nucleoporin 50kDa (NUP50)
TRV-0004363-01 10 µg

Recombinant Nucleoporin 50kDa (NUP50)

Sign In for Pricing
View Details