Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine IFN alpha protein

The Bovine IFN alpha A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IFN alpha A applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine IFN alpha A yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IFN alpha A Specifications: (Molecular Weight: 19.0 kDa) (Amino Acid Sequence: CHLPHTHSLA NRRVLMLLQQ LRRVSPSSCL QDRNDFEFLQ EALGGSQLQK AQAISVLHEV TQHTFQLFST EGSPATWDKS LLDKLRAALD QQLTDLQACL TQEEGLRGAP LLKEDSSLAV RKYFHRLTLY LQEKRHSPCA WEVVRAEVMR AFSSSTNLQE SFRRKD (166) ) (Gene ID: 515951) .

Product Specifications

Source

Yeast

Origin

Bovine

Field of Research

Infectious Disease & Virology

Purity

98%

Form

Lyophilized

Molecular Weight

19.0 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

CHLPHTHSLANRRVLMLLQQLRRVSPSSCLQDRNDFEFLQEALGGSQLQKAQAISVLHEVTQHTFQLFSTEGSPATWDKSLLDKLRAALDQQLTDLQACLTQEEGLRGAPLLKEDSSLAVRKYFHRLTLYLQEKRHSPCAWEVVRAEVMRAFSSSTNLQESFRRKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Bromo-2- (2,4-difluorophenoxy) pyrimidine
ABC28276-01 50 mg

5-Bromo-2- (2,4-difluorophenoxy) pyrimidine

Sign In for Pricing
View Details
5-Bromo-2- (2,4-difluorophenoxy) pyrimidine
ABC28276-02 0.5 g

5-Bromo-2- (2,4-difluorophenoxy) pyrimidine

Sign In for Pricing
View Details
Ethyl 3-hydroxy-2-methylpropanoate
OR1057064-01 100 mg

Ethyl 3-hydroxy-2-methylpropanoate

Sign In for Pricing
View Details
Ethyl 3-hydroxy-2-methylpropanoate
OR1057064-02 250 mg

Ethyl 3-hydroxy-2-methylpropanoate

Sign In for Pricing
View Details
Ethyl 3-hydroxy-2-methylpropanoate
OR1057064-03 1 g

Ethyl 3-hydroxy-2-methylpropanoate

Sign In for Pricing
View Details
Ethyl 3-hydroxy-2-methylpropanoate
OR1057064-04 5 g

Ethyl 3-hydroxy-2-methylpropanoate

Sign In for Pricing
View Details