Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine IFN alpha protein

The Bovine IFN alpha A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IFN alpha A applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine IFN alpha A yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IFN alpha A Specifications: (Molecular Weight: 19.0 kDa) (Amino Acid Sequence: CHLPHTHSLA NRRVLMLLQQ LRRVSPSSCL QDRNDFEFLQ EALGGSQLQK AQAISVLHEV TQHTFQLFST EGSPATWDKS LLDKLRAALD QQLTDLQACL TQEEGLRGAP LLKEDSSLAV RKYFHRLTLY LQEKRHSPCA WEVVRAEVMR AFSSSTNLQE SFRRKD (166) ) (Gene ID: 515951) .

Product Specifications

Source

Yeast

Origin

Bovine

Field of Research

Infectious Disease & Virology

Purity

98%

Form

Lyophilized

Molecular Weight

19.0 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

CHLPHTHSLANRRVLMLLQQLRRVSPSSCLQDRNDFEFLQEALGGSQLQKAQAISVLHEVTQHTFQLFSTEGSPATWDKSLLDKLRAALDQQLTDLQACLTQEEGLRGAPLLKEDSSLAVRKYFHRLTLYLQEKRHSPCAWEVVRAEVMRAFSSSTNLQESFRRKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TICAM2 Antibody
OACA07565-50UL 50 µL

TICAM2 Antibody

Sign In for Pricing
View Details
Zic1 Rabbit pAb, PerCP-Cy7 conjugated
orb2844763 100 µL

Zic1 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus UPF0060 membrane protein SAS2231 (SAS2231), partial
MBS7088982 Inquire

Recombinant Staphylococcus aureus UPF0060 membrane protein SAS2231 (SAS2231), partial

Sign In for Pricing
View Details
RNF144A Antibody
57-706 400 µL

RNF144A Antibody

Sign In for Pricing
View Details
Anti-Uroplakin Ib/UPIb Antibody Picoband® (Dylight488 Conjugate)
A10230-1-Dylight488 100 µg

Anti-Uroplakin Ib/UPIb Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
Mouse IL 6 "Super-X" Pre-Coated ELISA Kit
RMF600CKX2 2x 96 Tests

Mouse IL 6 "Super-X" Pre-Coated ELISA Kit

Sign In for Pricing
View Details