Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Equine CXCL9 protein

The Equine CXCL9 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CXCL9 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine CXCL9 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CXCL9 Specifications: (Molecular Weight: 12.0 kDa) (Amino Acid Sequence: APVMRKGRCSCIKTSQGTIRPKLLKDLKQFAPSPSCETTEIIATMKNGDQTCLNPDSAEVKELIKEWEKQVSQKKKQKKGKKHQKTKKFPKVKKWQRPRQKKAT) (Gene ID: 100057927) .

Product Specifications

Product Name Alternative

MIG

Source

Yeast

Origin

Equine

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

12.0 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

APVMRKGRCSCIKTSQGTIRPKLLKDLKQFAPSPSCETTEIIATMKNGDQTCLNPDSAEVKELIKEWEKQVSQKKKQKKGKKHQKTKKFPKVKKWQRPRQKKAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4 (T-Helper/Inducer Cell Marker) (RIV7), CF740 conjugate, 0.1mg/mL
BNC740362-100 1x 100 µL

CD4 (T-Helper/Inducer Cell Marker) (RIV7), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (135-4C5), CF405S conjugate, 0.1mg/mL
BNC040172-500 1x 500 µL

CD45 / LCA (135-4C5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Iduronate 2 sulfatase (IDS) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4G2]
TA504277AM 100 µL

Iduronate 2 sulfatase (IDS) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4G2]

Sign In for Pricing
View Details
RASGRP 4 (RASGRP4) (NM_001146206) Human Over-expression Lysate
LC431425 20 µg

RASGRP 4 (RASGRP4) (NM_001146206) Human Over-expression Lysate

Sign In for Pricing
View Details
CAVIN2 Human Gene Knockout Kit (CRISPR)
KN401962 1 Kit

CAVIN2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human CHMP6 activation kit by CRISPRa
GA112512 1 Kit

Human CHMP6 activation kit by CRISPRa

Sign In for Pricing
View Details