Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GYPA/CD235a, Human (His)

GYPA, also known as glycoprotein A, is a major membrane protein in red blood cells and plays an important role in the integrity of cell membranes. GYPA is a receptor for influenza virus, Plasmodium falciparum erythrocyte binding Antigen 175 (EBA-175), and hepatitis A virus (HAV) . GYPA/CD235a Protein, Human (His) is the recombinant human-derived GYPA/CD235a protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GYPA/CD235a Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gypa-cd235a-protein-human-his.html

Purity

95.0

Smiles

LSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE

Molecular Formula

2993 (Gene_ID) A0A0C4DFT7 (L20-E91) (Accession)

Molecular Weight

Approximately 11 kDa

References & Citations

[1]Suwanwootichai P, et al. Fatal haemolytic transfusion reaction due to anti-Ena and identification of a novel GYPA c.295delG variant in a Thai family. Vox Sang. 2022 Nov;117 (11) :1327-1331.|[2]Bigham AW, et al. Complex signatures of natural selection at GYPA. Hum Genet. 2018 Feb;137 (2) :151-160.|[3]Suades R, et al. Growing thrombi release increased levels of CD235a (+) microparticles and decreased levels of activated platelet-derived microparticles. Validation in ST-elevation myocardial infarction patients. J Thromb Haemost. 2015 Oct;13 (10) :1776-86.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat Sele, His tagged
Sele-4093R 100 µg

Recombinant Rat Sele, His tagged

Sign In for Pricing
View Details
S100A10 Protein Lysate (Human) with C-Ha Tag
42924031 100 µg

S100A10 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Rabbit Anti-Human CASP6 mAb
MA643-01 50 μL

Rabbit Anti-Human CASP6 mAb

Sign In for Pricing
View Details
Rabbit Anti-Human CASP6 mAb
MA643-02 100 μL

Rabbit Anti-Human CASP6 mAb

Sign In for Pricing
View Details
LRRTM3 Protein Vector (Rat) (pPB-C-His)
PV280218 500 ng

LRRTM3 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Lentiviral mouse Pde8a shRNA (UAS) - Lentiviral mouse Pde8a shRNA (UAS, iRFP) (100)
GTR15181587 1 Vial

Lentiviral mouse Pde8a shRNA (UAS) - Lentiviral mouse Pde8a shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details