Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GYPA/CD235a, Human (His)

GYPA, also known as glycoprotein A, is a major membrane protein in red blood cells and plays an important role in the integrity of cell membranes. GYPA is a receptor for influenza virus, Plasmodium falciparum erythrocyte binding Antigen 175 (EBA-175), and hepatitis A virus (HAV) . GYPA/CD235a Protein, Human (His) is the recombinant human-derived GYPA/CD235a protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GYPA/CD235a Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gypa-cd235a-protein-human-his.html

Purity

95.0

Smiles

LSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE

Molecular Formula

2993 (Gene_ID) A0A0C4DFT7 (L20-E91) (Accession)

Molecular Weight

Approximately 11 kDa

References & Citations

[1]Suwanwootichai P, et al. Fatal haemolytic transfusion reaction due to anti-Ena and identification of a novel GYPA c.295delG variant in a Thai family. Vox Sang. 2022 Nov;117 (11) :1327-1331.|[2]Bigham AW, et al. Complex signatures of natural selection at GYPA. Hum Genet. 2018 Feb;137 (2) :151-160.|[3]Suades R, et al. Growing thrombi release increased levels of CD235a (+) microparticles and decreased levels of activated platelet-derived microparticles. Validation in ST-elevation myocardial infarction patients. J Thromb Haemost. 2015 Oct;13 (10) :1776-86.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPO (NM_173077) Human Tagged Lenti ORF Clone
RC211315L4 10 µg

CPO (NM_173077) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Spata3 3'UTR GFP Stable Cell Line
TU271042 1.0 mL

Spata3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rat Indoleamine 2,3-Dioxygenase 1 ELISA Kit
MBS3809702-01 48 Well

Rat Indoleamine 2,3-Dioxygenase 1 ELISA Kit

Sign In for Pricing
View Details
Rat Indoleamine 2,3-Dioxygenase 1 ELISA Kit
MBS3809702-02 96 Well

Rat Indoleamine 2,3-Dioxygenase 1 ELISA Kit

Sign In for Pricing
View Details
Rat Indoleamine 2,3-Dioxygenase 1 ELISA Kit
MBS3809702-03 5x 96 Well

Rat Indoleamine 2,3-Dioxygenase 1 ELISA Kit

Sign In for Pricing
View Details
Rat Indoleamine 2,3-Dioxygenase 1 ELISA Kit
MBS3809702-04 10x 96 Well

Rat Indoleamine 2,3-Dioxygenase 1 ELISA Kit

Sign In for Pricing
View Details