Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine CCL5 protein

The Bovine CCL5 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL5 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine CCL5 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CCL5 Specifications: (Molecular Weight: 7.9 kDa) (Amino Acid Sequence: SPYASDTTPCCFAYISRPLPRTHVQEYFYTSSKCSMAAVVFITRKNRQVCANPEKKWVREYINALELS) (Gene ID: 327712) .

Product Specifications

Product Name Alternative

RANTES

Source

Yeast

Origin

Bovine

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

7.9 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

SPYASDTTPCCFAYISRPLPRTHVQEYFYTSSKCSMAAVVFITRKNRQVCANPEKKWVREYINALELS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal beta II Tubulin B Antibody (5B2) [Biotin]
NBP1-74037B 100 µL

Mouse Monoclonal beta II Tubulin B Antibody (5B2) [Biotin]

Sign In for Pricing
View Details
IPP Protein Vector (Mouse) (pPM-C-HA)
PV192088 500 ng

IPP Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
GPSM3 Antibody
A71998-100UG 100 µg

GPSM3 Antibody

Sign In for Pricing
View Details
Recombinant Mouse GRAM domain-containing protein 4 (Gramd4), partial
MBS7092407 Inquire

Recombinant Mouse GRAM domain-containing protein 4 (Gramd4), partial

Sign In for Pricing
View Details
IDH3G Protein Vector (Human) (pPM-C-His)
PV020732 500 ng

IDH3G Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
FASN (Fatty Acid Synthase, FAS, MGC14367, MGC15706, OA-519, SDR27X1)
245991 100 µg

FASN (Fatty Acid Synthase, FAS, MGC14367, MGC15706, OA-519, SDR27X1)

Sign In for Pricing
View Details