Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gallus IL-2 protein

The Chicken IL-2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken IL-2 applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken IL-2 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken IL-2 Specifications: (Molecular Weight: 14.0 kDa) (Amino Acid Sequence: ASLSSAKRKPLQTLIKDLEILENIKNKIHLELYTPTETQECTQQTLQCYLGEVVTLKKETEDDTEIKEEFVTAIQNIEKNLKSLTGLNHTGSECKICEANNKKKFPDFLHELTNFVRYLQK) (Gene ID: 373958) .

Product Specifications

Source

Yeast

Origin

Chicken

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

14.0 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

ASLSSAKRKPLQTLIKDLEILENIKNKIHLELYTPTETQECTQQTLQCYLGEVVTLKKETEDDTEIKEEFVTAIQNIEKNLKSLTGLNHTGSECKICEANNKKKFPDFLHELTNFVRYLQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Butylidene Phthalide(Cis Trans mixture)
TRC-B692250-5G 5 g

3-Butylidene Phthalide(Cis Trans mixture)

Sign In for Pricing
View Details
Myosin, Smooth Muscle Heavy Chain (SMMS-1), CF647 conjugate, 0.1mg/mL
BNC470893-500 1x 500 µL

Myosin, Smooth Muscle Heavy Chain (SMMS-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD81 Antibody[1.3.3.22]
E-AB-F1073M1-01 20 Tests

Elab Fluor® 700 Anti-Human CD81 Antibody[1.3.3.22]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD81 Antibody[1.3.3.22]
E-AB-F1073M1-02 100 Tests

Elab Fluor® 700 Anti-Human CD81 Antibody[1.3.3.22]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD81 Antibody[1.3.3.22]
E-AB-F1073M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Human CD81 Antibody[1.3.3.22]

Sign In for Pricing
View Details
Salicylazoiminopyridine (>85%)
TRC-S088100-25MG 25 mg

Salicylazoiminopyridine (>85%)

Sign In for Pricing
View Details