Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gallus IL-2 protein

The Chicken IL-2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken IL-2 applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken IL-2 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken IL-2 Specifications: (Molecular Weight: 14.0 kDa) (Amino Acid Sequence: ASLSSAKRKPLQTLIKDLEILENIKNKIHLELYTPTETQECTQQTLQCYLGEVVTLKKETEDDTEIKEEFVTAIQNIEKNLKSLTGLNHTGSECKICEANNKKKFPDFLHELTNFVRYLQK) (Gene ID: 373958) .

Product Specifications

Source

Yeast

Origin

Chicken

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

14.0 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

ASLSSAKRKPLQTLIKDLEILENIKNKIHLELYTPTETQECTQQTLQCYLGEVVTLKKETEDDTEIKEEFVTAIQNIEKNLKSLTGLNHTGSECKICEANNKKKFPDFLHELTNFVRYLQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAJA1 (DnaJ Homolog Subfamily A Member 1, DJ-2, DjA1, HDJ2, HSDJ, HSJ2, HSPF4, NEDD7, hDJ-2) (MaxLight 550)
MBS6414315-01 0.1 mL

DNAJA1 (DnaJ Homolog Subfamily A Member 1, DJ-2, DjA1, HDJ2, HSDJ, HSJ2, HSPF4, NEDD7, hDJ-2) (MaxLight 550)

Sign In for Pricing
View Details
DNAJA1 (DnaJ Homolog Subfamily A Member 1, DJ-2, DjA1, HDJ2, HSDJ, HSJ2, HSPF4, NEDD7, hDJ-2) (MaxLight 550)
MBS6414315-02 5x 0.1 mL

DNAJA1 (DnaJ Homolog Subfamily A Member 1, DJ-2, DjA1, HDJ2, HSDJ, HSJ2, HSPF4, NEDD7, hDJ-2) (MaxLight 550)

Sign In for Pricing
View Details
Recombinant Human KEAP1, N-His
MBS1574680-01 0.1 mg

Recombinant Human KEAP1, N-His

Sign In for Pricing
View Details
Recombinant Human KEAP1, N-His
MBS1574680-02 1 mg

Recombinant Human KEAP1, N-His

Sign In for Pricing
View Details
Recombinant Human KEAP1, N-His
MBS1574680-03 5x 1 mg

Recombinant Human KEAP1, N-His

Sign In for Pricing
View Details
Recombinant Polaromonas naphthalenivorans Large-conductance mechanosensitive channel (mscL)
orb2932154-01 20 µg

Recombinant Polaromonas naphthalenivorans Large-conductance mechanosensitive channel (mscL)

Sign In for Pricing
View Details