Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gallus IL-2 protein

The Chicken IL-2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken IL-2 applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken IL-2 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken IL-2 Specifications: (Molecular Weight: 14.0 kDa) (Amino Acid Sequence: ASLSSAKRKPLQTLIKDLEILENIKNKIHLELYTPTETQECTQQTLQCYLGEVVTLKKETEDDTEIKEEFVTAIQNIEKNLKSLTGLNHTGSECKICEANNKKKFPDFLHELTNFVRYLQK) (Gene ID: 373958) .

Product Specifications

Source

Yeast

Origin

Chicken

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

14.0 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

ASLSSAKRKPLQTLIKDLEILENIKNKIHLELYTPTETQECTQQTLQCYLGEVVTLKKETEDDTEIKEEFVTAIQNIEKNLKSLTGLNHTGSECKICEANNKKKFPDFLHELTNFVRYLQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

mmu-let-7g-5p miRNA Mimic
MBS8300635-01 5 nmol

mmu-let-7g-5p miRNA Mimic

Sign In for Pricing
View Details
mmu-let-7g-5p miRNA Mimic
MBS8300635-02 10 nmol

mmu-let-7g-5p miRNA Mimic

Sign In for Pricing
View Details
mmu-let-7g-5p miRNA Mimic
MBS8300635-03 5x 10 nmol

mmu-let-7g-5p miRNA Mimic

Sign In for Pricing
View Details
TRIOBP 3'UTR Luciferase Stable Cell Line
TU026610 1.0 mL

TRIOBP 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
RNASE4 Rabbit Polyclonal Antibody (PerCP)
orb2438198 100 µL

RNASE4 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
mmu-miR-6371 miRNA Antagomir
MNM02373 2x 5.0 nmol

mmu-miR-6371 miRNA Antagomir

Sign In for Pricing
View Details