Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gallus CCL4 protein

The Chicken CCL4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken CCL4 applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken CCL4 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken CCL4 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APVGSDPPTSCCFTYISRQLPFSFVADYYETNSQCPHAGVVFITRKGREVCANPENDWVQDYMNKMELN) (Gene ID: 395551) .

Product Specifications

Product Name Alternative

MIP-1 beta

Source

Yeast

Origin

Chicken

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

7.8 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

APVGSDPPTSCCFTYISRQLPFSFVADYYETNSQCPHAGVVFITRKGREVCANPENDWVQDYMNKMELN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Brucella Suis glsA Protein (strain 1330) (aa 1-317)
VAng-Lsx5589-1mgEcoli 1 mg (E. coli)

Recombinant Brucella Suis glsA Protein (strain 1330) (aa 1-317)

Sign In for Pricing
View Details
RBMY1A1 Protein Vector (Human) (pPB-N-His)
PV034686 500 ng

RBMY1A1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
trans-3'-Hydroxy Cotinine Perchlorate
TRC-H924600-10MG 10 mg

trans-3'-Hydroxy Cotinine Perchlorate

Sign In for Pricing
View Details
Aif1, Recombinant, Mouse, aa2-147, His-Tag (Allograft inflammatory Factor 1)
372191-01 20 µg

Aif1, Recombinant, Mouse, aa2-147, His-Tag (Allograft inflammatory Factor 1)

Sign In for Pricing
View Details
Aif1, Recombinant, Mouse, aa2-147, His-Tag (Allograft inflammatory Factor 1)
372191-02 100 µg

Aif1, Recombinant, Mouse, aa2-147, His-Tag (Allograft inflammatory Factor 1)

Sign In for Pricing
View Details
Sulindac sulfide
C03732-25mg 25 mg

Sulindac sulfide

Sign In for Pricing
View Details