Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gallus CCL4 protein

The Chicken CCL4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken CCL4 applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken CCL4 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken CCL4 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APVGSDPPTSCCFTYISRQLPFSFVADYYETNSQCPHAGVVFITRKGREVCANPENDWVQDYMNKMELN) (Gene ID: 395551) .

Product Specifications

Product Name Alternative

MIP-1 beta

Source

Yeast

Origin

Chicken

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

7.8 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

APVGSDPPTSCCFTYISRQLPFSFVADYYETNSQCPHAGVVFITRKGREVCANPENDWVQDYMNKMELN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DUX4 Antibody
E51A12374 100 µL

DUX4 Antibody

Sign In for Pricing
View Details
ITGA3 Antibody Blocking Peptide
orb72882 500 µg

ITGA3 Antibody Blocking Peptide

Sign In for Pricing
View Details
RETN (Resistin, ADSF, FIZZ3, MGC126603, MGC126609, RETN1, RSTN, XCP1) (MaxLight 490)
251047-ML490 100 µL

RETN (Resistin, ADSF, FIZZ3, MGC126603, MGC126609, RETN1, RSTN, XCP1) (MaxLight 490)

Sign In for Pricing
View Details
Human EFR3B Knockout A549 cell line
GTR15417979 1 Vial

Human EFR3B Knockout A549 cell line

Sign In for Pricing
View Details
DGCR8 (Microprocessor Complex Subunit DGCR8, DiGeorge Syndrome Critical Region 8, C22orf12, DGCRK6, LP4941) (MaxLight 490)
125794-ML490 100 µL

DGCR8 (Microprocessor Complex Subunit DGCR8, DiGeorge Syndrome Critical Region 8, C22orf12, DGCRK6, LP4941) (MaxLight 490)

Sign In for Pricing
View Details
Rabbit Polyclonal FKBP51/FKBP5 Antibody
NBP1-84677 0.1 mL

Rabbit Polyclonal FKBP51/FKBP5 Antibody

Sign In for Pricing
View Details