Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gallus CCL4 protein

The Chicken CCL4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken CCL4 applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken CCL4 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken CCL4 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APVGSDPPTSCCFTYISRQLPFSFVADYYETNSQCPHAGVVFITRKGREVCANPENDWVQDYMNKMELN) (Gene ID: 395551) .

Product Specifications

Product Name Alternative

MIP-1 beta

Source

Yeast

Origin

Chicken

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

7.8 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

APVGSDPPTSCCFTYISRQLPFSFVADYYETNSQCPHAGVVFITRKGREVCANPENDWVQDYMNKMELN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trnp1 Mouse siRNA Oligo Duplex (Locus ID 69539)
SR406026 1 Kit

Trnp1 Mouse siRNA Oligo Duplex (Locus ID 69539)

Sign In for Pricing
View Details
ACD Rabbit pAb
E45R18855N 50 ul

ACD Rabbit pAb

Sign In for Pricing
View Details
ZKSCAN3 Blocking Peptide
MBS9627041-01 1 mg

ZKSCAN3 Blocking Peptide

Sign In for Pricing
View Details
ZKSCAN3 Blocking Peptide
MBS9627041-02 5x 1 mg

ZKSCAN3 Blocking Peptide

Sign In for Pricing
View Details
OLR1406 Adenovirus (Rat)
33911056 1.0 mL

OLR1406 Adenovirus (Rat)

Sign In for Pricing
View Details
SIB 1893 500mg
A13759-500 500 mg

SIB 1893 500mg

Sign In for Pricing
View Details