Equine CCL3 protein

The Equine CCL3 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CCL3 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine CCL3 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CCL3 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: VPFGADTPTACCFSYVSRQIPRKFINDYYETSSQCSKPAIIFQTKRSRQVCADPSEAWVQEYVTDLELSA) (Gene ID: 100057909) .