Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Equine CCL11 protein

The Equine CCL11 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CCL11 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine CCL11 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CCL11 Specifications: (Molecular Weight: 9.0 kDa) (Amino Acid Sequence: AQPVSISTVCCFNVASRKISFQRLQSYRKITSSKCPQKAVIFKTKQAKKICADPKQKWVQDAMKYLDENSRTTKYSSF) (Gene ID: 100033949) .

Product Specifications

Product Name Alternative

Eotaxin

Source

Yeast

Origin

Equine

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

9.0 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

AQPVSISTVCCFNVASRKISFQRLQSYRKITSSKCPQKAVIFKTKQAKKICADPKQKWVQDAMKYLDENSRTTKYSSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SARS-CoV-2 Spike Trimer Protein, His Tag (BA.3/Omicron) (MALS verified)
SPN-C522c-10mg 10 mg

SARS-CoV-2 Spike Trimer Protein, His Tag (BA.3/Omicron) (MALS verified)

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS705339 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Rb (RB1) Rabbit Monoclonal Antibody [Clone ID: R04-1C4]
TA421538 100 µL

Rb (RB1) Rabbit Monoclonal Antibody [Clone ID: R04-1C4]

Sign In for Pricing
View Details
CD79b (B-Cell Marker) (IGB/3170R), Biotin conjugate, 0.1mg/mL
BNCB3170-500 1x 500 µL

CD79b (B-Cell Marker) (IGB/3170R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HCG-beta (HCGb/54), Biotin conjugate, 0.1mg/mL
BNCB0054-100 1x 100 µL

HCG-beta (HCGb/54), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG3 (Immunoglobulin G3) ELISA Kit
E-EL-H6088-01 24 Tests

Human IgG3 (Immunoglobulin G3) ELISA Kit

Sign In for Pricing
View Details