Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Equine CCL11 protein

The Equine CCL11 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CCL11 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine CCL11 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CCL11 Specifications: (Molecular Weight: 9.0 kDa) (Amino Acid Sequence: AQPVSISTVCCFNVASRKISFQRLQSYRKITSSKCPQKAVIFKTKQAKKICADPKQKWVQDAMKYLDENSRTTKYSSF) (Gene ID: 100033949) .

Product Specifications

Product Name Alternative

Eotaxin

Source

Yeast

Origin

Equine

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

9.0 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

AQPVSISTVCCFNVASRKISFQRLQSYRKITSSKCPQKAVIFKTKQAKKICADPKQKWVQDAMKYLDENSRTTKYSSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZAP70 pTyr493 Rabbit Polyclonal Antibody
AP02442PU-S 50 µL

ZAP70 pTyr493 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse CCL12/MCP-5 Antibody Pair Set
E-KAB-0316 50 µL & 100 µg

Mouse CCL12/MCP-5 Antibody Pair Set

Sign In for Pricing
View Details
BRAF35 (HMG20B) Human Gene Knockout Kit (CRISPR)
KN402444 1 Kit

BRAF35 (HMG20B) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rad9 (RAD9A) pTyr28 Rabbit Polyclonal Antibody
AP12692PU-N 400 µL

Rad9 (RAD9A) pTyr28 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse CCL8/MCP-2 Protein (His Tag)
PKSM040983-01 10 µg

Recombinant Mouse CCL8/MCP-2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse CCL8/MCP-2 Protein (His Tag)
PKSM040983-02 50 µg

Recombinant Mouse CCL8/MCP-2 Protein (His Tag)

Sign In for Pricing
View Details