Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Equine CCL11 protein

The Equine CCL11 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CCL11 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine CCL11 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CCL11 Specifications: (Molecular Weight: 9.0 kDa) (Amino Acid Sequence: AQPVSISTVCCFNVASRKISFQRLQSYRKITSSKCPQKAVIFKTKQAKKICADPKQKWVQDAMKYLDENSRTTKYSSF) (Gene ID: 100033949) .

Product Specifications

Product Name Alternative

Eotaxin

Source

Yeast

Origin

Equine

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

9.0 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

AQPVSISTVCCFNVASRKISFQRLQSYRKITSSKCPQKAVIFKTKQAKKICADPKQKWVQDAMKYLDENSRTTKYSSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Genius Dry Bath Incubator (dual block unit) ; without block
MD-02N-110/220 1 Unit

Genius Dry Bath Incubator (dual block unit) ; without block

Sign In for Pricing
View Details
TEP1 Human Gene Knockout Kit (CRISPR)
KN223614LP 1 Kit

TEP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human ASB16 activation kit by CRISPRa
GA114224 1 Kit

Human ASB16 activation kit by CRISPRa

Sign In for Pricing
View Details
GCSH Antibody
OC-923-01 50 μL

GCSH Antibody

Sign In for Pricing
View Details
GCSH Antibody
OC-923-02 100 µL

GCSH Antibody

Sign In for Pricing
View Details
GCSH Antibody
OC-923-03 1 mL

GCSH Antibody

Sign In for Pricing
View Details