Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Equine CCL5 protein

The Equine CCL5 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CCL5 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine CCL5 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CCL5 Specifications: (Molecular Weight: 7.9 kDa) (Amino Acid Sequence: SPYASDTTPCCFAYISRPLPRAHIQEYFYTSSKCSIPAVVFVTRKKRQVCANPEKKWVREYINTLEMS) (Gene ID: 100033925) .

Product Specifications

Product Name Alternative

RANTES

Source

Yeast

Origin

Equine

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

7.9 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

SPYASDTTPCCFAYISRPLPRAHIQEYFYTSSKCSIPAVVFVTRKKRQVCANPEKKWVREYINTLEMS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kylt® PEDV LD 25
31228 each

Kylt® PEDV LD 25

Sign In for Pricing
View Details
Olfr1463 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4216008 1.0 µg DNA

Olfr1463 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Bioprocess Systems Accessorie
CS0009 1 Each

Bioprocess Systems Accessorie

Sign In for Pricing
View Details
Recombinant Human Protein FAM118A (FAM118A)
orb2925807-01 20 µg

Recombinant Human Protein FAM118A (FAM118A)

Sign In for Pricing
View Details
Recombinant Human Protein FAM118A (FAM118A)
orb2925807-02 100 µg

Recombinant Human Protein FAM118A (FAM118A)

Sign In for Pricing
View Details
CD31 (PECAM-1, Platelet gpIIa Molecule) (PE)
C2383-23D-01 100 µg

CD31 (PECAM-1, Platelet gpIIa Molecule) (PE)

Sign In for Pricing
View Details