Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Equine CCL5 protein

The Equine CCL5 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CCL5 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine CCL5 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CCL5 Specifications: (Molecular Weight: 7.9 kDa) (Amino Acid Sequence: SPYASDTTPCCFAYISRPLPRAHIQEYFYTSSKCSIPAVVFVTRKKRQVCANPEKKWVREYINTLEMS) (Gene ID: 100033925) .

Product Specifications

Product Name Alternative

RANTES

Source

Yeast

Origin

Equine

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

7.9 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

SPYASDTTPCCFAYISRPLPRAHIQEYFYTSSKCSIPAVVFVTRKKRQVCANPEKKWVREYINTLEMS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEA (Carcinoembryonic) (FITC)
226867-FITC 100 µL

CEA (Carcinoembryonic) (FITC)

Sign In for Pricing
View Details
Anti-MUSK Mouse mAb
MBS475919-01 0.1 mL

Anti-MUSK Mouse mAb

Sign In for Pricing
View Details
Anti-MUSK Mouse mAb
MBS475919-02 5x 0.1 mL

Anti-MUSK Mouse mAb

Sign In for Pricing
View Details
4-Nitrophenyl 2-Acetamido-3-O- (3,4,6-tri-O-acetyl-2-deoxy-2-phthalimido-β-D-glucopyranosyl) -α-D-galactopyranoside
sc-284380 5 mg

4-Nitrophenyl 2-Acetamido-3-O- (3,4,6-tri-O-acetyl-2-deoxy-2-phthalimido-β-D-glucopyranosyl) -α-D-galactopyranoside

Sign In for Pricing
View Details
Zfp599 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
51041154 3x 1.0 µg DNA

Zfp599 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
TUSC3 Polyclonal Conjugated Antibody
orb1628496 100 µL

TUSC3 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details