Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine CCL11 protein

The Bovine CCL11 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL11 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine CCL11 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CCL11 Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: QPASIPTICCFNMSKKKISIQRLQSYRKITSSKCPQKAVIFNTKQNKKICVDPQEKWVQNAMEYLNQKSQTLKS) (Gene ID: 404072) .

Product Specifications

Product Name Alternative

Eotaxin-1

Source

Yeast

Origin

Bovine

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

8.6 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

QPASIPTICCFNMSKKKISIQRLQSYRKITSSKCPQKAVIFNTKQNKKICVDPQEKWVQNAMEYLNQKSQTLKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Box of 100 folded fast qualitative filter, 270 mm
QL02P0270 Box of 100

Box of 100 folded fast qualitative filter, 270 mm

Sign In for Pricing
View Details
Rabbit Polyclonal USP12 Antibody
NBP2-94449-0.02mL 0.02 mL

Rabbit Polyclonal USP12 Antibody

Sign In for Pricing
View Details
Reg Iα Antibody
N0554-01 50 µL

Reg Iα Antibody

Sign In for Pricing
View Details
Reg Iα Antibody
N0554-02 100 µL

Reg Iα Antibody

Sign In for Pricing
View Details
Reg Iα Antibody
N0554-03 200 µL

Reg Iα Antibody

Sign In for Pricing
View Details
Rabbit anti-RIOK3 Antibody
DL91321A-01 50 µL

Rabbit anti-RIOK3 Antibody

Sign In for Pricing
View Details