Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine CCL11 protein

The Bovine CCL11 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL11 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine CCL11 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CCL11 Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: QPASIPTICCFNMSKKKISIQRLQSYRKITSSKCPQKAVIFNTKQNKKICVDPQEKWVQNAMEYLNQKSQTLKS) (Gene ID: 404072) .

Product Specifications

Product Name Alternative

Eotaxin-1

Source

Yeast

Origin

Bovine

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

8.6 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

QPASIPTICCFNMSKKKISIQRLQSYRKITSSKCPQKAVIFNTKQNKKICVDPQEKWVQNAMEYLNQKSQTLKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEPCE Rabbit Polyclonal Antibody (Cy3)
orb2985525 100 µg

MEPCE Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
RNU6-44 sgRNA CRISPR Lentivector (Human) (Target 2)
K1853303 1.0 µg DNA

RNU6-44 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
PPP3CA sgRNA CRISPR Lentivector set (Human)
K1709001 3x 1.0 µg

PPP3CA sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
TAF1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2327205 3x 1.0 µg

TAF1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
RTCD1 CRISPR Knock Out 293T Cell Line (Human)
42858141 1x 10^6 Cells / 1.0 mL

RTCD1 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Recombinant Influenza A virus Protein PB1-F2 (PB1)
MBS1263392-01 0.02 mg (E-Coli)

Recombinant Influenza A virus Protein PB1-F2 (PB1)

Sign In for Pricing
View Details