Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine CCL11 protein

The Bovine CCL11 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL11 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine CCL11 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CCL11 Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: QPASIPTICCFNMSKKKISIQRLQSYRKITSSKCPQKAVIFNTKQNKKICVDPQEKWVQNAMEYLNQKSQTLKS) (Gene ID: 404072) .

Product Specifications

Product Name Alternative

Eotaxin-1

Source

Yeast

Origin

Bovine

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

8.6 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

QPASIPTICCFNMSKKKISIQRLQSYRKITSSKCPQKAVIFNTKQNKKICVDPQEKWVQNAMEYLNQKSQTLKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATXN7L1 (NM_152749) Human Over-expression Lysate
E45H14716-2 20 µg

ATXN7L1 (NM_152749) Human Over-expression Lysate

Sign In for Pricing
View Details
FAM80A (RIMKLA) (NM_173642) Human Untagged Clone
SC317626 10 µg

FAM80A (RIMKLA) (NM_173642) Human Untagged Clone

Sign In for Pricing
View Details
Hsa-miR-106a-3p miRNA Antagomir
orb1915810-01 10 nmol

Hsa-miR-106a-3p miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-106a-3p miRNA Antagomir
orb1915810-02 20 nmol

Hsa-miR-106a-3p miRNA Antagomir

Sign In for Pricing
View Details
ATIC Peptide
orb2015625 100 µg

ATIC Peptide

Sign In for Pricing
View Details
CDKN2A Conjugated Antibody
C32050 100 µL

CDKN2A Conjugated Antibody

Sign In for Pricing
View Details