Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine IL-1F5 protein

The Bovine IL-36 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-36 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine IL-36 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-36 Specifications: (Molecular Weight: 17.1 kDa) (Amino Acid Sequence: MVLSGALCFRMKDAALKVLYLHDNQLLAGGLQAGKVIKGEEISVVPNRSLDAKLSPVILGVHGGSQCLSCGTGQEPTLKLEPVNIMELYHSAEKSKKFTFYRRDTGLTSSFESAAYPGWFLCTVPEADQPLQITQLPKDTSWDNPIIDFYFQQCD) (Gene ID: 518514) .

Product Specifications

Source

Yeast

Origin

Bovine

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

17.1 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

MVLSGALCFRMKDAALKVLYLHDNQLLAGGLQAGKVIKGEEISVVPNRSLDAKLSPVILGVHGGSQCLSCGTGQEPTLKLEPVNIMELYHSAEKSKKFTFYRRDTGLTSSFESAAYPGWFLCTVPEADQPLQITQLPKDTSWDNPIIDFYFQQCD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ODN TTAGGG control
tlrl-ttagc-1 1 mg

ODN TTAGGG control

Sign In for Pricing
View Details
Gamma catenin Rabbit Polyclonal Antibody (AP)
orb908031 100 µL

Gamma catenin Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
Lentiviral mouse 1700007K13Rik shRNA (UAS) - Lentiviral mouse 1700007K13Rik shRNA (UAS, RFP) (100)
GTR15271764 1 Vial

Lentiviral mouse 1700007K13Rik shRNA (UAS) - Lentiviral mouse 1700007K13Rik shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Recombinant African swine fever virus Envelope protein 165 (Ken-165), partial
MBS1012589-01 0.5 mg (E-Coli)

Recombinant African swine fever virus Envelope protein 165 (Ken-165), partial

Sign In for Pricing
View Details
Recombinant African swine fever virus Envelope protein 165 (Ken-165), partial
MBS1012589-02 0.05 mg (Baculovirus)

Recombinant African swine fever virus Envelope protein 165 (Ken-165), partial

Sign In for Pricing
View Details
Recombinant African swine fever virus Envelope protein 165 (Ken-165), partial
MBS1012589-03 0.5 mg (Yeast)

Recombinant African swine fever virus Envelope protein 165 (Ken-165), partial

Sign In for Pricing
View Details