Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Equine IL-17 protein

The Equine IL-17A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-17A applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-17A yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-17A Specifications: (Molecular Weight: 14.9 kDa) (Amino Acid Sequence: GIVIPQNPECPNTGDKNFPQNVKINLNVLNRKTNSRRASDYHNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVNAEGKVDFHMNSVPIQQEILVLRRESQNCPHSFQLEKMLVAVGCTCVTPIVRHMG) (Gene ID: 100034142) .

Product Specifications

Source

Yeast

Origin

Equine

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

14.9 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

GIVIPQNPECPNTGDKNFPQNVKINLNVLNRKTNSRRASDYHNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVNAEGKVDFHMNSVPIQQEILVLRRESQNCPHSFQLEKMLVAVGCTCVTPIVRHMG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD5 (CD5 Antigen, CD5 Molecule, LEU1, Lymphocyte Antigen CD5, Lymphocyte Antigen T1/Leu 1, Lymphocyte Glycoprotein T1/Leu1, p56 62, T cell Surface Glycoprotein CD5, T1) (Biotin)
C2256-12M-Biotin 100 µL

CD5 (CD5 Antigen, CD5 Molecule, LEU1, Lymphocyte Antigen CD5, Lymphocyte Antigen T1/Leu 1, Lymphocyte Glycoprotein T1/Leu1, p56 62, T cell Surface Glycoprotein CD5, T1) (Biotin)

Sign In for Pricing
View Details
Histone H3 Rabbit Polyclonal Antibody (HRP), 1 pack = 100 µL
BAL1438 1 Each

Histone H3 Rabbit Polyclonal Antibody (HRP), 1 pack = 100 µL

Sign In for Pricing
View Details
COQ6, NT (COQ6, Ubiquinone biosynthesis monooxygenase COQ6, Coenzyme Q10 monooxygenase 6) (PE) discontinued
034125-PE 200 µL

COQ6, NT (COQ6, Ubiquinone biosynthesis monooxygenase COQ6, Coenzyme Q10 monooxygenase 6) (PE) discontinued

Sign In for Pricing
View Details
ATF2 (Ab-69/51)
ANTY021030 100ug

ATF2 (Ab-69/51)

Sign In for Pricing
View Details
Crkl Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-3755R-BF350 100 µL

Crkl Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
TMEM99 (NM_001195387) Human Tagged ORF Clone
RG233572 10 µg

TMEM99 (NM_001195387) Human Tagged ORF Clone

Sign In for Pricing
View Details