Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Equine IL-17 protein

The Equine IL-17A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-17A applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-17A yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-17A Specifications: (Molecular Weight: 14.9 kDa) (Amino Acid Sequence: GIVIPQNPECPNTGDKNFPQNVKINLNVLNRKTNSRRASDYHNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVNAEGKVDFHMNSVPIQQEILVLRRESQNCPHSFQLEKMLVAVGCTCVTPIVRHMG) (Gene ID: 100034142) .

Product Specifications

Source

Yeast

Origin

Equine

Field of Research

Immunology & Inflammation

Purity

98%

Form

Lyophilized

Molecular Weight

14.9 kDa

Storage Conditions

-20°C

Notes

For research use only.

AA Sequence

GIVIPQNPECPNTGDKNFPQNVKINLNVLNRKTNSRRASDYHNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVNAEGKVDFHMNSVPIQQEILVLRRESQNCPHSFQLEKMLVAVGCTCVTPIVRHMG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(2H,4H-Spiro[benzo[b][1,4]dioxepine-3,1'-cyclopropan]-6-yl) boronic acid
OR1057001-01 100 mg

(2H,4H-Spiro[benzo[b][1,4]dioxepine-3,1'-cyclopropan]-6-yl) boronic acid

Sign In for Pricing
View Details
(2H,4H-Spiro[benzo[b][1,4]dioxepine-3,1'-cyclopropan]-6-yl) boronic acid
OR1057001-02 250 mg

(2H,4H-Spiro[benzo[b][1,4]dioxepine-3,1'-cyclopropan]-6-yl) boronic acid

Sign In for Pricing
View Details
(2H,4H-Spiro[benzo[b][1,4]dioxepine-3,1'-cyclopropan]-6-yl) boronic acid
OR1057001-03 1 g

(2H,4H-Spiro[benzo[b][1,4]dioxepine-3,1'-cyclopropan]-6-yl) boronic acid

Sign In for Pricing
View Details
ZWINT Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-7852R-BF488 100 µL

ZWINT Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Anti-BIRC2 Antibody (R2E43)
RHG55602 100 μg

Anti-BIRC2 Antibody (R2E43)

Sign In for Pricing
View Details
EGF Rabbit pAb, AP conjugated
orb2848155 100 µL

EGF Rabbit pAb, AP conjugated

Sign In for Pricing
View Details